HRP Anti-PSMD11 antibody (ab193139)
Key features and details
- HRP Rabbit polyclonal to PSMD11
- Suitable for: WB
- Reacts with: Mouse, Rat, Dog, Human, Zebrafish
- Conjugation: HRP
- Isotype: IgG
Overview
-
Product name
HRP Anti-PSMD11 antibody
See all PSMD11 primary antibodies -
Description
HRP Rabbit polyclonal to PSMD11 -
Host species
Rabbit -
Conjugation
HRP -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Dog, Human, Zebrafish
Predicted to work with: Cow
-
Immunogen
Recombinant full length protein corresponding to Human PSMD11 aa 2-422.
Sequence:AAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSIL ELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEA ATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGS QLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIY CPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSL KYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLAD FEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHIS SLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAAL ETIQNMSKVVDSLYNKAKKLT
Database link: O00231 -
Positive control
- EC109 whole cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), 49% PBS, 0.03% Proclin 300 -
Concentration information loading... -
Purity
Caprylic Acid - Ammonium Sulfate precipitation -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab193139 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/20 - 1/300. Predicted molecular weight: 47 kDa. |
Target
-
Function
Component of the lid subcomplex of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. In the complex, PSMD11 is required for proteasome assembly. Plays a key role in increased proteasome activity in embryonic stem cells (ESCs): its high expression in ESCs promotes enhanced assembly of the 26S proteasome, followed by higher proteasome activity. -
Tissue specificity
Highly expressed in embryonic stem cells (ESCs). Expression decreases as ESCs differentiate. -
Sequence similarities
Belongs to the proteasome subunit S9 family.
Contains 1 PCI domain. -
Post-translational
modificationsPhosphorylated by AMPK. -
Cellular localization
Nucleus. Cytoplasm > cytosol. - Information by UniProt
-
Database links
- Entrez Gene: 513461 Cow
- Entrez Gene: 480610 Dog
- Entrez Gene: 5717 Human
- Entrez Gene: 69077 Mouse
- Entrez Gene: 303353 Rat
- Entrez Gene: 322265 Zebrafish
- Omim: 604449 Human
- SwissProt: Q2KI42 Cow
see all -
Alternative names
- 26S proteasome non-ATPase regulatory subunit 11 antibody
- 26S proteasome regulatory subunit 9 antibody
- 26S proteasome regulatory subunit p44.5 antibody
see all
Images
-
Western blot - HRP Anti-PSMD11 antibody (ab193139)HRP Anti-PSMD11 antibody (ab193139) at 2 µg/ml + EC109 whole cell lysate at 20 µg
Secondary
Goat polyclonal to Rabbit IgG at 1/15000 dilution
Predicted band size: 47 kDa
Observed band size: 47 kDa
References (0)
ab193139 has not yet been referenced specifically in any publications.
