HRP Anti-VDAC1/Porin antibody [N152B/23] (ab186337)
Key features and details
- HRP Mouse monoclonal [N152B/23] to VDAC1/Porin
- Reacts with: Rat
- Conjugation: HRP
- Isotype: IgG2a
Overview
-
Product name
HRP Anti-VDAC1/Porin antibody [N152B/23]
See all VDAC1/Porin primary antibodies -
Description
HRP Mouse monoclonal [N152B/23] to VDAC1/Porin -
Host species
Mouse -
Conjugation
HRP -
Species reactivity
Reacts with: Rat
Predicted to work with: Mouse, Rabbit, Cow, Human, Pig -
Immunogen
Recombinant full length protein corresponding to Human VDAC1/Porin aa 1-283.
Sequence:MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTE TTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFD SSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWL AGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNK KLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQT LKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
Database link: P21796 -
Positive control
- Rat brain lysate.
-
General notes
The clone number has been updated from S152B-23 to N152B/23, both clone numbers name the same antibody clone.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
Preservative: 0.1% Sodium azide
Constituents: 49% PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
N152B/23 -
Isotype
IgG2a -
Research areas
Associated products
-
Alternative Versions
-
Recombinant Protein
Target
-
Function
Forms a channel through the mitochondrial outer membrane and also the plasma membrane. The channel at the outer mitochondrial membrane allows diffusion of small hydrophilic molecules; in the plasma membrane it is involved in cell volume regulation and apoptosis. It adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective. May participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis. -
Tissue specificity
Heart, liver and skeletal muscle. -
Sequence similarities
Belongs to the eukaryotic mitochondrial porin family. -
Domain
Consists mainly of a membrane-spanning beta-barrel formed by 19 beta-strands. The helical N-terminus folds back into the pore opening and plays a role in voltage-gated channel activity. -
Cellular localization
Mitochondrion outer membrane. Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 282119 Cow
- Entrez Gene: 7416 Human
- Entrez Gene: 22333 Mouse
- Entrez Gene: 397010 Pig
- Entrez Gene: 100008751 Rabbit
- Entrez Gene: 83529 Rat
- Omim: 604492 Human
- SwissProt: P45879 Cow
see all -
Alternative names
- N2441 antibody
- OMP2 antibody
- POR1 antibody
see all
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab186337 has not yet been referenced specifically in any publications.