Overview

  • Product name

    Anti-HS1BP3 antibody - C-terminal
  • Description

    Rabbit polyclonal to HS1BP3 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Orangutan
  • Immunogen

    Synthetic peptide within Human HS1BP3 aa 342-392 (C terminal). The exact sequence is proprietary. (NP_071905.3).
    Sequence:

    RKPAVPPKAGPAEAVAGQQKPQEQIQAMDEMDILQYIQDHDTPAQAAPSL F


    Database link: Q53T59

  • Positive control

    • HeLa, 293T and Jurkat whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab200592 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 43 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

Images

  • All lanes : Anti-HS1BP3 antibody - C-terminal (ab200592) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 43 kDa


    Exposure time: 3 minutes
  • Detection of HS1BP3 in immunoprecipitates of HeLa whole cell lysate (prepared using NETN lysis buffer; 1 mg for IP, 20% of IP loaded) using ab200592 at 6 µg/mg lysate for IP and at 0.4 µg/ml for subsequent Western blot detection (Lane 1). Lane 2 represents control IgG IP.
    Detection: Chemiluminescence with an exposure time of 30 seconds.

References

ab200592 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200592.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up