Overview

  • Product name

  • Description

    Rabbit polyclonal to HSCB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human HSCB aa 30-235.
    Sequence:

    AASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDC NRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYK TLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEA AMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIK LKKIPL


    Database link: Q8IWL3

  • Positive control

    • WB: U-87 whole cell lysate; Rat heart and liver lysates. IHC-P: Human small intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235055 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 27 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    May act as a co-chaperone in iron-sulfur cluster assembly in mitochondria.
  • Tissue specificity

    Liver, muscle and heart.
  • Pathway

    Cofactor biosynthesis; iron-sulfur cluster biosynthesis.
  • Sequence similarities

    Belongs to the hscB family.
    Contains 1 J domain.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • AI325508 antibody
    • AW049829 antibody
    • dJ366L4.2 antibody
    • DnaJ (Hsp40) homolog, subfamily C member 20 antibody
    • DnaJ homolog subfamily C member 20 antibody
    • DNAJC20 antibody
    • Hsc20 antibody
    • HSC20_HUMAN antibody
    • hscB antibody
    • HscB iron sulfur cluster co chaperone homolog antibody
    • Iron sulfur cluster co chaperone protein HscB mitochondrial antibody
    • Iron-sulfur cluster co-chaperone protein HscB antibody
    • J type co chaperone HSC20 antibody
    • JAC1 antibody
    • mitochondrial antibody
    • RGD1311005 antibody
    • RP3-366L4.2 antibody
    see all

Images

  • All lanes : Anti-HSCB antibody (ab235055) at 1/500 dilution

    Lane 1 : U-87 MG (human glioblastoma-astrocytoma epithelial cell line) cell lysate
    Lane 2 : Rat heart lysate
    Lane 3 : Rat liver lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 27 kDa

  • Paraffin-embedded human small intestine tissue stained for HSCB using ab235055 at 1/100 dilution in immunohistochemical analysis.

References

ab235055 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235055.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up