Anti-HSD11B2 antibody (ab244510)
Key features and details
- Rabbit polyclonal to HSD11B2
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-HSD11B2 antibody
See all HSD11B2 primary antibodies -
Description
Rabbit polyclonal to HSD11B2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human HSD11B2 aa 71-104.
Sequence:SDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQA FFISHCLPRALQPGQPGTTPPQDAAQDPNLSPG
Database link: P80365 -
Positive control
- IHC-P: Human kidney, lymph node and rectum tissue. ICC/IF: RT4 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab244510 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids. -
Tissue specificity
Found in placenta, kidney, pancreas, prostate, ovary, small intestine and colon. -
Involvement in disease
Defects in HSD11B2 are the cause of apparent mineralocorticoid excess (AME) [MIM:218030]. AME is a potentially fatal disease characterized by severe juvenile low-renin hypertension, sodium retention, hypokalemia and low levels of aldosterone. It often leads to nephrocalcinosis. -
Sequence similarities
Belongs to the short-chain dehydrogenases/reductases (SDR) family. -
Cellular localization
Microsome. Endoplasmic reticulum. - Information by UniProt
-
Database links
- Entrez Gene: 3291 Human
- Omim: 614232 Human
- SwissProt: P80365 Human
- Unigene: 1376 Human
-
Alternative names
- 11 beta HSD2 antibody
- 11 beta hydroxysteroid dehydrogenase type 2 antibody
- 11 DH2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HSD11B2 antibody (ab244510)Paraffin-embedded human rectum tissue stained for HSD11B2 using ab244510 at 1/500 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HSD11B2 antibody (ab244510)Paraffin-embedded human kidney tissue stained for HSD11B2 using ab244510 at 1/500 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HSD11B2 antibody (ab244510)Paraffin-embedded human lymph node tissue stained for HSD11B2 using ab244510 at 1/500 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HSD11B2 antibody (ab244510)
Paraffin-embedded human liver tissue stained for HSD11B2 using ab244510 at 1/500 dilution in immunohistochemical analysis. Low expression, as expected.
-
PFA-fixed, Triton X-100 permeabilized RT4 (human urinary bladder cancer cell line) cells stained for HSD11B2 (green) using ab244510 at 4 μg/ml in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab244510 has not yet been referenced specifically in any publications.