Anti-HSD11B2 antibody (ab244510)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-HSD11B2 antibody
See all HSD11B2 primary antibodies -
Description
Rabbit polyclonal to HSD11B2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human HSD11B2 aa 71-104.
Sequence:SDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQA FFISHCLPRALQPGQPGTTPPQDAAQDPNLSPG
Database link: P80365 -
Positive control
- IHC-P: Human kidney, lymph node and rectum tissue. ICC/IF: RT4 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab244510 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids. -
Tissue specificity
Found in placenta, kidney, pancreas, prostate, ovary, small intestine and colon. -
Involvement in disease
Defects in HSD11B2 are the cause of apparent mineralocorticoid excess (AME) [MIM:218030]. AME is a potentially fatal disease characterized by severe juvenile low-renin hypertension, sodium retention, hypokalemia and low levels of aldosterone. It often leads to nephrocalcinosis. -
Sequence similarities
Belongs to the short-chain dehydrogenases/reductases (SDR) family. -
Cellular localization
Microsome. Endoplasmic reticulum. - Information by UniProt
-
Database links
- Entrez Gene: 3291 Human
- Omim: 614232 Human
- SwissProt: P80365 Human
- Unigene: 1376 Human
-
Alternative names
- 11 beta HSD2 antibody
- 11 beta hydroxysteroid dehydrogenase type 2 antibody
- 11 DH2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HSD11B2 antibody (ab244510)Paraffin-embedded human rectum tissue stained for HSD11B2 using ab244510 at 1/500 dilution in immunohistochemical analysis. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HSD11B2 antibody (ab244510)Paraffin-embedded human kidney tissue stained for HSD11B2 using ab244510 at 1/500 dilution in immunohistochemical analysis. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HSD11B2 antibody (ab244510)Paraffin-embedded human lymph node tissue stained for HSD11B2 using ab244510 at 1/500 dilution in immunohistochemical analysis. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HSD11B2 antibody (ab244510)Paraffin-embedded human liver tissue stained for HSD11B2 using ab244510 at 1/500 dilution in immunohistochemical analysis. Low expression, as expected.
-
Immunocytochemistry/ Immunofluorescence - Anti-HSD11B2 antibody (ab244510)PFA-fixed, Triton X-100 permeabilized RT4 (human urinary bladder cancer cell line) cells stained for HSD11B2 (green) using ab244510 at 4 μg/ml in ICC/IF.
Datasheets and documents
References
ab244510 has not yet been referenced specifically in any publications.
