Overview

  • Product name

  • Description

    Rabbit polyclonal to HSD17B1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human HSD17B1 aa 4-289. Two N-terminal tags. Expressed in E.coli.
    Sequence:

    MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA RALACPPGSLETLQLDVRDSKSVAAARERVTEGRVDVLVCNAGLGLLGPL EALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGGLMGL PFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGS PEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKP TLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGG GAGPGAEDEAGRGAVGDPELGDPPAAPQ


    Database link: P14061

  • Positive control

    • IHC-P: Human breast cancer tissue. WB: Recombinant human HSD17B1 protein; Human liver lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab232881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Favors the reduction of estrogens and androgens. Also has 20-alpha-HSD activity. Uses preferentially NADH.
  • Pathway

    Steroid biosynthesis; estrogen biosynthesis.
  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 17 beta HSD 1 antibody
    • 17 beta hydroxysteroid dehydrogenase type 1 antibody
    • 17-beta-HSD 1 antibody
    • 17-beta-hydroxysteroid dehydrogenase type 1 antibody
    • 20 alpha-hydroxysteroid dehydrogenase antibody
    • 20-alpha-HSD antibody
    • DHB1_HUMAN antibody
    • E17KSR antibody
    • E2DH antibody
    • EDH17B1 antibody
    • EDH17B2 antibody
    • EDHB17 antibody
    • Estradiol 17 beta dehydrogenase 1 antibody
    • Estradiol 17-beta-dehydrogenase 1 antibody
    • HSD17 antibody
    • HSD17B1 antibody
    • Hydroxysteroid (17 beta) dehydrogenase 1 antibody
    • MGC13814 antibody
    • Placental 17 beta hydroxysteroid dehydrogenase antibody
    • Placental 17-beta-hydroxysteroid dehydrogenase antibody
    • SDR28C1 antibody
    • Short chain dehydrogenase/reductase family 28CE,member 1 antibody
    see all

Images

  • Anti-HSD17B1 antibody (ab232881) at 5 µg/ml + Human liver tissue lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for HSD17B1 using ab232881 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-HSD17B1 antibody (ab232881) at 2 µg/ml + Recombinant human HSD17b1 protein.

References

ab232881 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232881.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up