Overview

  • Product name

  • Description

    Rabbit polyclonal to HSD3B7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISA, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human HSD3B7 aa 121-170. NP_079469.2
    Sequence:

    TRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHRHPYPCSKALAEWLV


    Database link: Q9H2F3

  • Positive control

    • Human kidney tissue; Hela, MCF7 and COLO cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol, 0.87% Sodium chloride

    PBS is without Mg2+ and Ca2+
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190223 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 41 kDa.
ELISA 1/20000.
IHC-P Use a concentration of 10 µg/ml.

Target

  • Relevance

    The 3 beta HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. HSD3B7 is active against four 7-alpha-hydroxylated sterols and is nvolved in bile acid synthesis.
  • Cellular localization

    Endoplasmic reticulum membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • 3 beta HSD VII antibody
    • 3 beta hydroxy Delta(5) C27 steroid oxidoreductase antibody
    • 3 beta hydroxysteroid dehydrogenase type 7 antibody
    • 3 beta hydroxysteroid dehydrogenase type VII antibody
    • AI195443 antibody
    • BB098564 antibody
    • C(27) 3 beta HSD antibody
    • Cca2 antibody
    • Cholest 5 ene 3 beta,7 alpha diol 3 beta dehydrogenase antibody
    • Confluent 3Y1 cell associated 2 antibody
    • Hydroxy delta 5 steroid dehydrogenase, 3 beta and steroid delta isomerase 7 antibody
    • OTTMUSP00000018894 antibody
    • OTTMUSP00000018895 antibody
    • OTTMUSP00000018897 antibody
    • PFIC4 antibody
    • SDR11E3 antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human kidney tissue labeling HSD3B7 with ab190223 at 10 µg/ml.

  • All lanes : Anti-HSD3B7 antibody (ab190223) at 1/500 dilution

    Lane 1 : Hela cell lysate
    Lane 2 : MCF7 cell lysate
    Lane 3 : COLO cell lysate
    Lane 4 : Hela cell lysate with immununizing peptide

    Predicted band size: 41 kDa

References

ab190223 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190223.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up