Overview

  • Product name

  • Description

    Rabbit polyclonal to Hsp40
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Mouse Hsp40 aa 2-340. (Expressed in E.coli).
    Sequence:

    GKDYYQTLGLARGASDDEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEA YDVLSDPRKREIFDRYGEEGLKGGSPSGGSSGGANGTSFSYTFHGDPHAM FAEFFGGRNPFDTFFGQRNGEEGMDIDDTFSSFPMGMGGFTNMNFGRSRP SQEPTRKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNED KILTIEVKRGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDG SDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEG LPLPKTPEKRGDLVIEFEVIFPERIPVSSRTILEQVLPI


    Database link: Q9QYJ3

  • Positive control

    • WB: Recombinant mouse Hsp40 protein; Mouse liver lysate; Jurkat and HeLa cell lysates. IHC-P: Mouse testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231577 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 38 kDa.

Target

  • Function

    Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP.
  • Sequence similarities

    Contains 1 J domain.
  • Cellular localization

    Cytoplasm. Nucleus. Nucleus > nucleolus. Translocates rapidly from the cytoplasm to the nucleus, and especially to the nucleoli, upon heat shock.
  • Information by UniProt
  • Database links

  • Alternative names

    • DnaJ (Hsp40) homolog subfmaily B member 1 antibody
    • DNAJ 1 antibody
    • DNAJ B1 antibody
    • DnaJ heat shock protein family (Hsp40) member B1 antibody
    • DnaJ homolog subfamily B member 1 antibody
    • DnaJ protein homolog 1 antibody
    • DNAJ1 antibody
    • DNAJB 1 antibody
    • Dnajb1 antibody
    • DNAJB1 protein antibody
    • DNJB1_HUMAN antibody
    • HDJ 1 antibody
    • HDJ-1 antibody
    • HDJ1 antibody
    • Heat shock 40 kDa protein 1 antibody
    • Heat shock 40kD protein 1 antibody
    • Heat shock protein 40 antibody
    • Hsp 40 antibody
    • HSP40 antibody
    • HSPF 1 antibody
    • HSPF1 antibody
    • Human DnaJ protein 1 antibody
    • Radial spoke 16 homolog B antibody
    • RSPH16B antibody
    • Sis1 antibody
    see all

Images

  • Anti-Hsp40 antibody (ab231577) at 3 µg/ml + Recombinant mouse Hsp40 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 38 kDa

  • All lanes : Anti-Hsp40 antibody (ab231577) at 3 µg/ml

    Lane 1 : Mouse liver lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 38 kDa

  • Paraffin-embedded mouse testis tissue stained for Hsp40 using ab231577 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse testis tissue stained for Hsp40 using ab231577 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231577 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231577.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up