Overview

  • Product name

  • Description

    Rabbit polyclonal to Hsp70
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Cow, Dog, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Hsp70 aa 285-641. (Expressed in E.coli).
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFDSLFEGIDFYTSIT RARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQK LLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAP LSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERA MTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKA NKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFN MKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKE LEQVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD


    Database link: P0DMV8

  • Positive control

    • IHC-P: Human stomach, brain, prostate, kidney breast cancer and prostate cancer tissues. WB: Pig liver and brain lysates; Mouse liver lysate; A549 cell lysate; Recombinant human Hsp70 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231128 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 70 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    Function: In cooperation with other chaperones, the Hsp70 family stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. In case of rotavirus A infection, serves as a post-attachment receptor for the virus to facilitate entry into the cell. Tissue specificity: HSPA1B is testis-specific.
  • Cellular localization

    Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Database links

  • Alternative names

    • DnaK type molecular chaperone HSP70 1 antibody
    • Epididymis secretory protein Li 103 antibody
    • FLJ54303 antibody
    • FLJ54370 antibody
    • FLJ54392 antibody
    • FLJ54408 antibody
    • FLJ75127 antibody
    • Heat shock 70 kDa protein 1 antibody
    • Heat shock 70 kDa protein 1/2 antibody
    • Heat shock 70 kDa protein 1A antibody
    • Heat shock 70 kDa protein 1A/1B antibody
    • Heat shock 70kDa protein 1B antibody
    • Heat shock induced protein antibody
    • HEL S 103 antibody
    • HSP70 1 antibody
    • HSP70 1A antibody
    • HSP70 1B antibody
    • HSP70 2 antibody
    • HSP70-1 antibody
    • HSP70-1/HSP70-2 antibody
    • HSP70-1A antibody
    • HSP70-2 antibody
    • HSP70.1 antibody
    • HSP70.1/HSP70.2 antibody
    • HSP71_HUMAN antibody
    • HSP72 antibody
    • HSPA1 antibody
    • HSPA1A antibody
    • HSPA1B antibody
    see all

Images

  • Paraffin-embedded human stomach tissue stained for Hsp70 using ab231128 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human brain tissue stained for Hsp70 using ab231128 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate tissue stained for Hsp70 using ab231128 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for Hsp70 using ab231128 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human breast cancer tissue stained for Hsp70 using ab231128 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate cancer tissue stained for Hsp70 using ab231128 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Hsp70 antibody (ab231128) at 2 µg/ml + Recombinant human Hsp70 protein

    Predicted band size: 70 kDa

  • All lanes : Anti-Hsp70 antibody (ab231128) at 2 µg/ml

    Lane 1 : Pig liver lysate
    Lane 2 : Pig brain lysate
    Lane 3 : Mouse liver lysate
    Lane 4 : A549 (human lung carcinoma cell line) cell lysate

    Predicted band size: 70 kDa

  • All lanes : Anti-Hsp70 antibody (ab231128) at 2 µg/ml

    Lane 1 : Wild-type A549 (human lung carcinoma cell line) cell lysate
    Lane 2 : Hsp70 knockout A549 (human lung carcinoma cell line) cell lysate

    Predicted band size: 70 kDa

References

ab231128 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up