Overview

  • Product name

  • Description

    Rabbit polyclonal to Hsp70
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Cow
    Predicted to work with: Mouse, Rat, Dog, Human, Pig, Orangutan
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Cow Hsp70 aa 1-641. Expressed in E.coli. N-terminal tag.
    Sequence:

    MGHHHHHHSGSEFMAKNMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRT TPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDM KHWPFRVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGH PVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDR TGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRL VNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSL FEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLV GGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEN VQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPG VLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILN VTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVS AKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLA EKDEFEHKRKELEQVCNPIISRLYQGAGGPGAGGFGAQGPKGGSGSGPTI EEVD


    Database link: Q27975

  • Positive control

    • WB: Recombinant cow Hsp70 protein; cow cerebrum, kidney and liver lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231538 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 70 kDa.

Target

  • Relevance

    Function: In cooperation with other chaperones, the Hsp70 family stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. In case of rotavirus A infection, serves as a post-attachment receptor for the virus to facilitate entry into the cell. Tissue specificity: HSPA1B is testis-specific.
  • Cellular localization

    Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Database links

  • Alternative names

    • DnaK type molecular chaperone HSP70 1 antibody
    • Epididymis secretory protein Li 103 antibody
    • FLJ54303 antibody
    • FLJ54370 antibody
    • FLJ54392 antibody
    • FLJ54408 antibody
    • FLJ75127 antibody
    • Heat shock 70 kDa protein 1 antibody
    • Heat shock 70 kDa protein 1/2 antibody
    • Heat shock 70 kDa protein 1A antibody
    • Heat shock 70 kDa protein 1A/1B antibody
    • Heat shock 70kDa protein 1B antibody
    • Heat shock induced protein antibody
    • HEL S 103 antibody
    • HSP70 1 antibody
    • HSP70 1A antibody
    • HSP70 1B antibody
    • HSP70 2 antibody
    • HSP70-1 antibody
    • HSP70-1/HSP70-2 antibody
    • HSP70-1A antibody
    • HSP70-2 antibody
    • HSP70.1 antibody
    • HSP70.1/HSP70.2 antibody
    • HSP71_HUMAN antibody
    • HSP72 antibody
    • HSPA1 antibody
    • HSPA1A antibody
    • HSPA1B antibody
    see all

Images

  • Anti-Hsp70 antibody (ab231538) at 2 µg/ml + Cow cerebrum lysate

    Predicted band size: 70 kDa

  • Anti-Hsp70 antibody (ab231538) at 2 µg/ml + Cow kidney lysate

    Predicted band size: 70 kDa

  • Anti-Hsp70 antibody (ab231538) at 2 µg/ml + Cow liver lysate

    Predicted band size: 70 kDa

  • Anti-Hsp70 antibody (ab231538) at 2 µg/ml + Recombinant cow Hsp70 protein

    Predicted band size: 70 kDa

References

ab231538 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231538.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up