Overview

  • Product name

    Anti-Hsp70 antibody [C7]
    See all Hsp70 primary antibodies
  • Description

    Mouse monoclonal [C7] to Hsp70
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Cow, Dog, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Hsp70 aa 285-641. N-terminal His-tag and T7-tag (Expressed in E.coli).
    Sequence:

    DSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDL VLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDK SENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDN QPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANG ILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRE RVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDAN TLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSG PTIEEVD


    Database link: P0DMV8

  • Positive control

    • WB: Recombinant human Hsp70 protein; Pig cerebrum and liver lysate; HeLa and Jurkat cell lysate. IHC-P: Human breast cancer and prostate tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    C7
  • Isotype

    IgG2b
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab239732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml.
IHC-P Use a concentration of 5 - 30 µg/ml.

Target

  • Relevance

    Function: In cooperation with other chaperones, the Hsp70 family stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. In case of rotavirus A infection, serves as a post-attachment receptor for the virus to facilitate entry into the cell. Tissue specificity: HSPA1B is testis-specific.
  • Cellular localization

    Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Database links

  • Alternative names

    • DnaK type molecular chaperone HSP70 1 antibody
    • Epididymis secretory protein Li 103 antibody
    • FLJ54303 antibody
    • FLJ54370 antibody
    • FLJ54392 antibody
    • FLJ54408 antibody
    • FLJ75127 antibody
    • Heat shock 70 kDa protein 1 antibody
    • Heat shock 70 kDa protein 1/2 antibody
    • Heat shock 70 kDa protein 1A antibody
    • Heat shock 70 kDa protein 1A/1B antibody
    • Heat shock 70kDa protein 1B antibody
    • Heat shock induced protein antibody
    • HEL S 103 antibody
    • HSP70 1 antibody
    • HSP70 1A antibody
    • HSP70 1B antibody
    • HSP70 2 antibody
    • HSP70-1 antibody
    • HSP70-1/HSP70-2 antibody
    • HSP70-1A antibody
    • HSP70-2 antibody
    • HSP70.1 antibody
    • HSP70.1/HSP70.2 antibody
    • HSP71_HUMAN antibody
    • HSP72 antibody
    • HSPA1 antibody
    • HSPA1A antibody
    • HSPA1B antibody
    see all

Images

  • Paraffin-embedded human breast cancer tissue stained for Hsp70 using ab239732 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Hsp70 antibody [C7] (ab239732) at 3 µg/ml + Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate

    Secondary
    HRP-Linked Goat anti-Mouse IgG at 0.2 µg/ml
  • Paraffin-embedded human prostate tissue stained for Hsp70 using ab239732 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Hsp70 antibody [C7] (ab239732) at 3 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    HRP-Linked Goat anti-Mouse IgG at 0.2 µg/ml
  • Anti-Hsp70 antibody [C7] (ab239732) at 3 µg/ml + Pig liver lysate

    Secondary
    HRP-Linked Goat anti-Mouse IgG at 0.2 µg/ml
  • Anti-Hsp70 antibody [C7] (ab239732) at 3 µg/ml + Pig cerebrum lysate

    Secondary
    HRP-Linked Goat anti-Mouse IgG at 0.2 µg/ml
  • Anti-Hsp70 antibody [C7] (ab239732) at 5 µg/ml + Recombinant human Hsp70 protein

References

ab239732 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239732.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up