Anti-HSPA1L antibody (ab233153)
Key features and details
- Rabbit polyclonal to HSPA1L
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-HSPA1L antibody
See all HSPA1L primary antibodies -
Description
Rabbit polyclonal to HSPA1L -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Rat, Human
Predicted to work with: Mouse, Cow, Pig, Cynomolgus monkey -
Immunogen
Recombinant full length protein (His-tag) corresponding to Human HSPA1L aa 1-641. Expressed in E. coli. N-terminal tag.
Sequence:MATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTE RLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEG GKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVPA YFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIF DLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRK HKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT RARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQR LLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAP LSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERA MTKDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKV NKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFN MKSVVSDEGLKGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKE LEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Database link: P34931 -
Positive control
- ICC/IF: HeLa cells. IHC-P: Human testis tissue. WB: Recombinant human HSPA1L protein. HeLa, Raji and HepG2 cell lysate. Rat testis tissue lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab233153 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.5 - 2 µg/ml. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
ICC/IF | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. -
Tissue specificity
Expressed in spermatids. -
Sequence similarities
Belongs to the heat shock protein 70 family. - Information by UniProt
-
Database links
- Entrez Gene: 540190 Cow
- Entrez Gene: 3305 Human
- Entrez Gene: 15482 Mouse
- Entrez Gene: 100144518 Pig
- Entrez Gene: 24963 Rat
- Omim: 140559 Human
- SwissProt: P0CB32 Cow
- SwissProt: P34931 Human
see all -
Alternative names
- Heat shock 70 kDa protein 1 Hom antibody
- Heat shock 70 kDa protein 1 like antibody
- Heat shock 70 kDa protein 1-Hom antibody
see all
Images
-
Anti-HSPA1L antibody (ab233153) at 1 µg/ml + Rat testis tissue lysate
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HSPA1L antibody (ab233153)
Formalin-fixed, paraffin-embedded human testis tissue stained for HSPA1L with ab233153 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for HSPA1L using ab233153 at 20 µg/ml in ICC/IF. FITC staining.
-
Anti-HSPA1L antibody (ab233153) at 1 µg/ml + Raji (Human Burkitt's lymphoma cell line) cell lysate
-
Anti-HSPA1L antibody (ab233153) at 1 µg/ml + Human HepG2 cell lysate
-
Anti-HSPA1L antibody (ab233153) at 1 µg/ml + HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate
-
Anti-HSPA1L antibody (ab233153) at 2 µg/ml + Recombinant human HSPA1L protein
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab233153 has not yet been referenced specifically in any publications.