Overview

  • Product name

  • Description

    Rabbit polyclonal to HSPB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse HSPB2 aa 12-170. (Expressed in E.coli).
    Sequence:

    ATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAARAGEGAR AGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHG FVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVY ISLLPAPPD


    Database link: Q99PR8

  • Positive control

    • IHC-P: Mouse liver tissue. WB: Mouse skeletal muscle lysate; Rat heart lysate; Recombinant mouse HSPB2 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231520 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 20 kDa.

Target

Images

  • Formalin-fixed, paraffin-embedded mouse liver tissue stained for HSPB2 using ab231520 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-HSPB2 antibody (ab231520) at 2 µg/ml + Recombinant mouse HSPB2 protein

    Predicted band size: 20 kDa

  • Anti-HSPB2 antibody (ab231520) at 2 µg/ml + Mouse skeletal muscle lysate

    Predicted band size: 20 kDa

  • Anti-HSPB2 antibody (ab231520) at 2 µg/ml + Rat heart lysate

    Predicted band size: 20 kDa

References

ab231520 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231520.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up