Overview

  • Product name

  • Description

    Rabbit polyclonal to HSPB7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human HSPB7 aa 1-170. (Expressed in E.coli).
    Sequence:

    MSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSD DFGSFMRPHSEPLAFPARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTT SNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIR ARRHPHTEHVQQTFRTEIKI


    Database link: Q9UBY9

  • Positive control

    • IHC-P: Human kidney, cerebrum, liver and glioma tissues. WB: Pig skeletal muscle lysate; Recombinant human HSPB7 protein.
  • General notes

     This product was previously labelled as cvHSP

     

Properties

Applications

Our Abpromise guarantee covers the use of ab232744 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 19 kDa.

Target

  • Tissue specificity

    Isoform 1 is highly expressed in adult and fetal heart, skeletal muscle, and at a much lower levels in adipose tissue and in aorta. Undetectable in other tissues. Isoform 2 and isoform 3 are poorly detected in heart.
  • Sequence similarities

    Belongs to the small heat shock protein (HSP20) family.
  • Cellular localization

    Cytoplasm. Nucleus. Nucleus > Cajal body. Resides in sub-nuclear structures known as SC35 speckles or nuclear splicing speckles.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cardiovascular heat shock protein antibody
    • cvHsp antibody
    • DKFZp779D0968 antibody
    • FLJ32733 antibody
    • Heat shock 27kda protein family member 7 antibody
    • Heat shock protein beta 7 antibody
    • Heat shock protein beta-7 antibody
    • Hsp25 2 antibody
    • HspB7 antibody
    • HSPB7_HUMAN antibody
    • Hypothetical protein flj34956 antibody
    • RP11-5P18.6 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for HSPB7 using ab232744 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human cerebrum tissue stained for HSPB7 using ab232744 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver tissue stained for HSPB7 using ab232744 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human glioma tissue stained for HSPB7 using ab232744 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-HSPB7 antibody (ab232744) at 2 µg/ml + Recombinant human HSPB7 protein

    Predicted band size: 19 kDa

  • Anti-HSPB7 antibody (ab232744) at 1 µg/ml + Pig skeletal muscle lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/1000 dilution

    Predicted band size: 19 kDa

References

ab232744 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232744.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up