Overview

  • Product name

  • Description

    Rabbit polyclonal to htrA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Escherichia coli
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Escherichia coli htrA1 aa 304-442. Expressed in E.coli. N-terminal tag.
    Sequence:

    MGHHHHHHSGS-KAMKVDAQRGAFVSQVLPNSSAAKAGI KAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLEL QQSSQNQVDSSTIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKG DVIIGANQQAVK

  • Positive control

    • WB: Recombinant E. coli htrA1 protein. E.coli lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231195 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Protease that regulate the availability of nsulin-like growth factors (IGFs) by cleaving IGF-binding proteins. Represses signaling by TGF-beta family members.
  • Tissue specificity

    Expressed in a variety of tissues, with strongest expression in placenta.
  • Involvement in disease

    Variations in the promoter region of HTRA1 are the cause of susceptibility to age-related macular degeneration type 7 (ARMD7) [MIM:610149]. ARMD is the leading cause of vision loss and blindness among older individuals in the developed word. It is classified as either dry (nonneovascular) or wet (neovascular). ARMD7 is a wet form, in which new blood vessels form and break beneath the retina. This leakage causes permanent damage to surrounding retinal tissue, distorting and destroying central vision. Wet ARMD is more prevalent among Asians than Caucasians.
    Defects in HTRA1 are the cause of cerebral autosomal recessive arteriopathy with subcortical infarcts and leukoencephalopathy (CARASIL) [MIM:600142]. CARASIL is characterized by nonhypertensive cerebral small-vessel arteriopathy with subcortical infarcts, alopecia, and spondylosis, with an onset in early adulthood. On neuropathological examination, arteriosclerosis associated with intimal thickening and dense collagen fibers, loss of vascular smooth-muscle cells, and hyaline degeneration of the tunica media has been observed in cerebral small arteries.
  • Sequence similarities

    Belongs to the peptidase S1B family.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 Kazal-like domain.
    Contains 1 PDZ (DHR) domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Alternative names

    • ARMD7 antibody
    • CARASIL antibody
    • High-temperature requirement A serine peptidase 1 antibody
    • HtrA antibody
    • HtrA serine peptidase 1 antibody
    • HTRA1 antibody
    • HTRA1_HUMAN antibody
    • IGFBP5 protease antibody
    • L56 antibody
    • ORF480 antibody
    • Protease serine 11 (IGF binding) antibody
    • protease serine 11 antibody
    • PRSS11 antibody
    • Serine protease 11 antibody
    • Serine protease HTRA1 antibody
    • Serine protease HTRA1 precursor antibody
    see all

Images

  • Anti-htrA1 antibody (ab231195) at 2 µg/ml + E.coli lysate
  • Anti-htrA1 antibody (ab231195) at 2 µg/ml + Recombinant E. coli htra1 protein

References

ab231195 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231195.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up