Overview

  • Product name

    Anti-HtrA2 / Omi antibody - C-terminal
    See all HtrA2 / Omi primary antibodies
  • Description

    Rabbit polyclonal to HtrA2 / Omi - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human HtrA2/ Omi aa 334-458 (C terminal).
    Sequence:

    PSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPS FPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRT QSQLAVQIRRGRETLTLYVTPEVTE


    Database link: O43464

  • Positive control

    • WB: HeLa, HEK-293, Jurkat, MCF7 and Raji whole cell lysates. IHC-P: Human colon cancer and kidney tissues. IP: MCF7 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab229878 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 49 kDa (predicted molecular weight: 49 kDa).
IP 1/200 - 1/2000.

Target

  • Function

    Serine protease that shows proteolytic activity against a non-specific substrate beta-casein. Promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. Cleaves THAP5 and promotes its degradation during apoptosis. Isoform 2 seems to be proteolytically inactive.
  • Tissue specificity

    Isoform 1 is ubiquitous. Isoform 2 is expressed predominantly in the kidney, colon and thyroid.
  • Involvement in disease

    Defects in HTRA2 are the cause of Parkinson disease type 13 (PARK13) [MIM:610297]. A complex neurodegenerative disorder characterized by bradykinesia, resting tremor, muscular rigidity and postural instability, as well as by a clinically significant response to treatment with levodopa. The pathology involves the loss of dopaminergic neurons in the substantia nigra and the presence of Lewy bodies (intraneuronal accumulations of aggregated proteins), in surviving neurons in various areas of the brain.
  • Sequence similarities

    Belongs to the peptidase S1B family.
    Contains 1 PDZ (DHR) domain.
  • Domain

    The mature N-terminus is involved in the interaction with XIAP.
    The PDZ domain mediates interaction with MXI2.
  • Post-translational
    modifications

    Autoproteolytically activated.
  • Cellular localization

    Mitochondrion intermembrane space. Mitochondrion membrane. Predominantly present in the intermembrane space. Released into the cytosol following apoptotic stimuli, such as UV treatment, and stimulation of mitochondria with caspase-8 truncated BID/tBID.
  • Information by UniProt
  • Database links

  • Alternative names

    • High temperature requirement protein A2 antibody
    • HTRA 2 antibody
    • HtrA like serine protease antibody
    • HtrA serine peptidase 2 antibody
    • HtrA, E. coli, homolog of, 2 antibody
    • HtrA2 antibody
    • HTRA2_HUMAN antibody
    • mitochondrial antibody
    • Omi stress regulated endoprotease antibody
    • Omi stress-regulated endoprotease antibody
    • PARK 13 antibody
    • PARK13 antibody
    • Protease serine 25 antibody
    • PRSS 25 antibody
    • PRSS25 antibody
    • Serine protease 25 antibody
    • Serine protease HTRA2 antibody
    • Serine protease HTRA2 mitochondrial antibody
    • Serine protease htra2 mitochondrial precursor antibody
    • Serine protease omi antibody
    • Serine proteinase OMI antibody
    see all

Images

  • All lanes : Anti-HtrA2 / Omi antibody - C-terminal (ab229878) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 3 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 4 : Raji (human Burkitt's lymphoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 49 kDa
    Observed band size: 49 kDa

  • Paraffin-embedded human colon cancer tissue stained for HtrA2 / Omi using ab229878 at 1/200 dilution in immunohistochemical analysis, followed by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

    Antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight.

  • HtrA2 / Omi was immunoprecipitated from 0.5 mg MCF7 (human breast adenocarcinoma cell line) whole cell lysate using 8 µg of ab229878. Western blot was performed from the immunoprecipitate using ab229878. HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

    Lane 1: 1 µg Control IgG instead of ab229878 in MCF7 whole cell lysate.
    Lane 2: ab229878 in MCF7 whole cell lysate.
    Lane 3: MCF7 whole cell lysate 20 µg (Input).

  • Paraffin-embedded human kidney tissue stained for HtrA2 / Omi using ab229878 at 1/200 dilution in immunohistochemical analysis, followedby a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

    Antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. 

  • All lanes : Anti-HtrA2 / Omi antibody - C-terminal (ab229878) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 49 kDa
    Observed band size: 49 kDa

References

ab229878 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229878.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up