Overview

  • Product name

  • Description

    Rabbit polyclonal to HUCE1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HUCE1 aa 158-256.
    Sequence:

    AWKGSTTNDPPKQSPGSTSPKPPHTLSRKQWRNRQKNKRRCKNKFQPPQV PDQAPAEAPTEKTEVSPVPRTDSHEARAGALRARMAQRLDGARFRYLNE


    Database link: O43159

  • Positive control

    • RT-4 cell lysate; U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220906 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 51 kDa.

Target

  • Function

    Essential component of the eNoSC (energy-dependent nucleolar silencing) complex, a complex that mediates silencing of rDNA in response to intracellular energy status and acts by recruiting histone-modifying enzymes. The eNoSC complex is able to sense the energy status of cell: upon glucose starvation, elevation of NAD(+)/NADP(+) ratio activates SIRT1, leading to histone H3 deacetylation followed by dimethylation of H3 at 'Lys-9' (H3K9me2) by SUV39H1 and the formation of silent chromatin in the rDNA locus. In the complex, RRP8 binds to H3K9me2 and probably acts as a methyltransferase. Its substrates are however unknown.
  • Sequence similarities

    Belongs to the methyltransferase superfamily. RRP8 family.
  • Cellular localization

    Nucleus > nucleolus. Localizes at rDNA locus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cerebral protein 1 antibody
    • hypothetical protein LOC23378 antibody
    • KIAA0409 antibody
    • NML antibody
    • Nucleomethylin antibody
    • Ribosomal RNA processing 8 methyltransferase homolog antibody
    • Ribosomal RNA processing 8, methyltransferase, homolog (yeast) antibody
    • Ribosomal RNA processing protein 8 antibody
    • Ribosomal RNA-processing protein 8 antibody
    • RRP 8 antibody
    • RRP8 antibody
    • RRP8 methyltransferase homolog antibody
    • RRP8_HUMAN antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling HUCE1 with ab220906 at 4 µg/ml (green).

  • Anti-HUCE1 antibody (ab220906) at 1/100 dilution + RT-4 cell lysate

    Predicted band size: 51 kDa

References

ab220906 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220906.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up