Description

  • Product name

    Human GLP2 peptide
  • Animal free

    No
  • Nature

    Synthetic
    • Species

      Human
    • Sequence

      HADGSFSDEMNTILDNLAARDFINWLIQTKITD
    • Amino acids

      146 to 178

Associated products

Specifications

Our Abpromise guarantee covers the use of ab42332 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-GLP2 antibody (ab14183)

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Constituent: 0.1% Acetic acid

  • Reconstitution
    Resuspend in 100ul 0.1% acetic acid

General Info

  • Alternative names

    • GCG
    • GLP 2
    • Glucagon like peptide 2
    • GRPP
  • Relevance

    Human GLP2 (glucagon like peptide 2) is a peptide hormone of the glucagon family produced by the L cells of the intestial mucosa and originates from the same prohormone as glucagon. GLP2 has been shown to be an important growth factor for the intestinal mucosa.
  • Cellular localization

    Secreted

References

ab42332 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

The purity is > 90% (HPLC)

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up