Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
    • Amino acids
      1 to 34

Associated products

Specifications

Our Abpromise guarantee covers the use of ab42334 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None

General Info

  • Alternative names
    • hPTH
    • Parathormone
    • Parathyrin
    • Parathyroid hormone
    • Parathyroid hormone 1
    • Prepro PTH
    • Preproparathyroid hormone
    • PTH
    • PTH1
    • PTH1 receptor
    • PTH1R
    • PTHR
    • PTHR1
    • PTHY_HUMAN
    see all
  • Function
    PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
  • Involvement in disease
    Defects in PTH are a cause of familial isolated hypoparathyroidism (FIH) [MIM:146200]; also called autosomal dominant hypoparathyroidism or autosomal dominant hypocalcemia. FIH is characterized by hypocalcemia and hyperphosphatemia due to inadequate secretion of parathyroid hormone. Symptoms are seizures, tetany and cramps. FIH exist both as autosomal dominant and recessive forms of hypoparathyroidism.
  • Sequence similarities
    Belongs to the parathyroid hormone family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab42334 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

DISCOUNT CODE: XXXXXXXXXX
Expiration date: 09/09/2012

I am very pleased to hear you would like to accept our offer and test ab85205 in [Rat]. This code will give you: 1 free [PRIMARY ANTIBODY/PROTEIN] OR VALUE OFF OF ORDER before the expiration date. To redeem this offer, please submit an Abreview for [Rat] and include this code in the “Additional Comments” section so we know the Abreview is for this promotion. For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews.

Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code.

Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

The terms and conditions applicable to this offer can be found here: www.abcam.com/collaborationdiscount.

Read More

Answer

Thank you for contacting us.

The immunogen sequence of ab85205 is 100% similar to rat parathyroid hormone related protein so it is more likely that this antibody will be able to detect the protein.

This antibody is eligible for 100% Abreview discount programme; would you like us to create a discount code for customer?

We are also giving away free protein ladder. Please click the below given link and order ab123069.

https://www.abcam.com/index.html?pageconfig=resource&rid=14968

The protein ab42334 is a peptide, this is not a full length protein so it will not be a right choice. We unfortunately do not have full length active Parathyroid Hormone protein that can be used for receptor activation. You may need to consider checking other vendors websites.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Use our products? Submit an Abreview. Earn rewards!
https://www.abcam.com/abreviews

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up