Description

  • Product name

    Human PRG-5 peptide
  • Animal free

    No
  • Nature

    Synthetic
    • Species

      Human
    • Sequence

      FTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGET
    • Amino acids

      36 to 84

Associated products

Specifications

Our Abpromise guarantee covers the use of ab238792 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-PRG-5 antibody (ab84659)

  • Form

    Lyophilised
  • Additional notes

    Blocking peptide for ab84659.

    Previously labelled as PAP2D.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Reconstitution
    Add 100ul of sterile PBS.

General Info

  • Alternative names

    • Lipid phosphate phosphatase related protein type 5
    • Lipid phosphate phosphatase-related protein type 5
    • lppr5
    • LPPR5_HUMAN
    • PAP2
    • PAP2D
    • Phosphatidic acid phosphatase 2d
    • Phosphatidic acid phosphatase related 5
    • Phosphatidic acid phosphatase type 2
    • Phosphatidic acid phosphatase type 2d
    • Plasticity related protein 5
    • Plasticity-related gene 5 protein
    • PRG 5
    • PRG-5
    • PRG5
    see all
  • Tissue specificity

    Isoform 1 is expressed in brain, lung, kidney and colon. Isoform 2 is expressed in placenta, skeletal muscle and kidney.
  • Sequence similarities

    Belongs to the PA-phosphatase related phosphoesterase family.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab238792 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238792.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up