Description

  • Product name

    Human SGPP1 peptide
  • Animal free

    No
  • Nature

    Synthetic
    • Species

      Human
    • Sequence

      THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT
    • Amino acids

      187 to 236
    • Additional sequence information

      Synthetic peptide corresponding to a region within internal sequence amino acids 287-336 (THKYAPFIII GLHLALGIFS FTLDTWSTSR GDTAEILGSG AGIACGSHVT) of Human sphingosine-1-phosphate phosphatase 1

Associated products

Specifications

Our Abpromise guarantee covers the use of ab223885 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Form

    Lyophilised
  • Additional notes

    Blocking peptide for ab108435.

    Previously labelled as sphingosine-1-phosphate phosphatase 1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS.

General Info

  • Alternative names

    • hSPPase1
    • SGPP1
    • Sphingosine-1-phosphatase 1
    • sphingosine-1-phosphate phosphatase 1
    • Spp1
    • SPPase1
    see all
  • Relevance

    SGPP1 (Spp1) regulates intracellular and extracellular sphingosine 1 phosphate(S1P)levels. It belongs to the type 2 lipid phosphate phosphatase family and is expressed in the endoplasmic reticulum (ER) membrane.

References

This product has been referenced in:

  • Schwiebs A  et al. Nuclear Translocation of SGPP-1 and Decrease of SGPL-1 Activity Contribute to Sphingolipid Rheostat Regulation of Inflammatory Dendritic Cells. Mediators Inflamm 2017:5187368 (2017). Read more (PubMed: 29375197) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223885.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up