Description

  • Product name

    Human SLC2A13 peptide
  • Animal free

    No
  • Nature

    Synthetic
    • Species

      Human
    • Sequence

      PAVIQFFGFLFLPESPRWLIQKGQTQKARRI
    • Amino acids

      248 to 278

Associated products

Specifications

Our Abpromise guarantee covers the use of ab232797 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking

  • Form

    Lyophilised
  • Additional notes

    Blocking peptide for ab190163.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

  • Reconstitution
    Reconstitute in distilled water

General Info

  • Alternative names

    • 6530403A04
    • A630029G22Rik
    • AI505012
    • Gm308
    • H(+)-myo-inositol cotransporter
    • H(+)-myo-inositol symporter
    • Hmit
    • MGC48624
    • MYCT_HUMAN
    • Proton myo-inositol cotransporter
    • Slc2a13
    • Solute carrier family 2 (facilitated glucose transporter), member 13
    see all
  • Function

    H(+)-myo-inositol cotransporter. Can also transport related stereoisomers.
  • Tissue specificity

    Predominantly expressed in the brain.
  • Sequence similarities

    Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family.
  • Post-translational
    modifications

    Glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab232797 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232797.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up