Description

  • Product name

    Human SLC5A4 peptide
  • Animal free

    No
  • Nature

    Synthetic
    • Species

      Human
    • Sequence

      ASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKTN
    • Amino acids

      1 to 50

Specifications

Our Abpromise guarantee covers the use of ab81335 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • DJ90G24.4
    • Low affinity sodium glucose cotransporter
    • Na(+)/glucose cotransporter 3
    • SAAT1
    • SGLT2
    • SGLT3
    • Sodium/glucose cotransporter 3
    • Solute carrier family 5 member 4
    see all
  • Relevance

    SLC5A4 is a sodium dependent low affinity glucose cotransporter.
  • Cellular localization

    Multipass membrane protein

References

ab81335 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab81335.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up