Overview

  • Product name

  • Description

    Rabbit polyclonal to hunchback
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Drosophila melanogaster
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 (MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPI P) of Human hunchback (NP_731268).

  • Positive control

    • Drosophila Cell Lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab105674 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.25 µg/ml. Predicted molecular weight: 83 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Gap class segmentation protein that controls development of head structures.
  • Tissue specificity

    In embryo, expression of maternal transcript is highest in anterior region. Zygotic transcript is expressed in anterior region until the beginning of gastrulation and in posterior region until early gastrulation. After this, it is expressed in developing nervous system.
  • Sequence similarities

    Belongs to the hunchback C2H2-type zinc-finger protein family.
    Contains 6 C2H2-type zinc fingers.
  • Developmental stage

    Expressed maternally and zygotically. Expression of the maternal transcript decreases until embryonic stage 14, zygotic transcript is first detected at stage 11.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

    • Alternative names

      • CG9786 antibody
      • Dmel\CG9786 antibody
      • hb antibody
      • HUNB_DROME antibody
      • Protein hunchback antibody
      • R pbx antibody
      • Regulator of postbithorax antibody
      • Rg bx antibody
      • Rg pbx antibody
      see all

    Images

    • Anti-hunchback antibody (ab105674) at 0.25 µg/ml + Drosophila Cell Lysate at 10 µg

      Predicted band size: 83 kDa



      Gel concentration:12%

    References

    ab105674 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab105674.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up