Overview

  • Product name
    Anti-HuR / ELAVL1 antibody
    See all HuR / ELAVL1 primary antibodies
  • Description
    Rabbit polyclonal to HuR / ELAVL1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human HuR/ ELAVL1 aa 1-326. NP_001410.2
    Sequence:

    MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAK LIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSS EVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVA FIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLY HSPARRFGGPVHHQAQRFRFSPMGVDHMSGLSGVNVPGNASSGWCIFIYN LGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAM AIASLNGYRLGDKILQVSFKTNKSHK


    Database link: Q15717

  • Positive control
    • WB: U-251 MG, HeLa, Jurkat, K562 and PC-3 cell extracts. IHC-P: Rat brain and testis tissue. Mouse testis and kidney tissue; Human colon, esophagus, esophageal cancer, stomach, gastric cancer, kidney and kidney cancer tissue; Rat cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238528 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 36 kDa.
IHC-P 1/100 - 1/200.

Target

  • Function
    Involved in 3'-UTR ARE-mediated MYC stabilization. Binds avidly to the AU-rich element in FOS and IL3/interleukin-3 mRNAs. In the case of the FOS AU-rich element, HUR binds to a core element of 27 nucleotides that contain AUUUA, AUUUUA and AUUUUUA motifs.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the RRM elav family.
    Contains 3 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications
    Methylated at Arg-217 by CARM1 in macrophages in response to LPS challenge.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • ELAV (embryonic lethal abnormal vision Drosophila) like 1 antibody
    • ELAV (embryonic lethal, abnormal vision, Drosophila) like 1 (Hu antigen R) antibody
    • ELAV like 1 antibody
    • ELAV like RNA binding protein 1 antibody
    • ELAV-like protein 1 antibody
    • ELAV1 antibody
    • ELAV1_HUMAN antibody
    • Elavl1 antibody
    • Embryonic lethal abnormal vision drosophila homolog like 1 antibody
    • Hu Antigen R antibody
    • Hu-antigen R antibody
    • Hua antibody
    • HuR antibody
    • MelG antibody
    see all

Images

  • All lanes : Anti-HuR / ELAVL1 antibody (ab238528) at 1/1000 dilution

    Lane 1 : Wild-type HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : HuR / ELAVL1 knockout HEK-293 cell lysate

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : HRP Goat Anti-Rabbit IgG (H+L) at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 36 kDa


    Exposure time: 90 seconds


    Blocking buffer: 3% nonfat dry milk in TBST.

  • All lanes : Anti-HuR / ELAVL1 antibody (ab238528) at 1/1000 dilution

    Lane 1 : U-251 MG (Human brain glioma cell line) cell extracts
    Lane 2 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell extracts
    Lane 3 : Jurkat (Human T cell leukemia cell line from peripheral blood) cell extracts
    Lane 4 : K562 (Human chronic myelogenous leukemia cell line from bone marrow) cell extracts
    Lane 5 : PC-3 (Human prostate adenocarcinoma cell line) cell extracts

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : HRP Goat Anti-Rabbit IgG (H+L) at 1/10000 dilution

    Predicted band size: 36 kDa



    Blocking buffer: 3% non-fat dry milk in TBST.

  • Paraffin-embedded human colon tissue stained for HuR / ELAVL1 with ab238528 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded rat testis tissue stained for HuR / ELAVL1 with ab238528 at a 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse testis tissue stained for HuR / ELAVL1 with ab238528 at a 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded rat brain tissue stained for HuR / ELAVL1 with ab238528 at a 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse kidney tissue stained for HuR / ELAVL1 with ab238528 at a 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human esophagus tissue stained for HuR / ELAVL1 with ab238528 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human esophageal cancer tissue stained for HuR / ELAVL1 with ab238528 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human stomach tissue stained for HuR / ELAVL1 with ab238528 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gastric cancer tissue stained for HuR / ELAVL1 with ab238528 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for HuR / ELAVL1 with ab238528 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney cancer tissue stained for HuR / ELAVL1 with ab238528 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded rat cancer tissue stained for HuR / ELAVL1 with ab238528 at a 1/200 dilution in immunohistochemical analysis.

References

ab238528 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238528.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up