Overview

  • Product name

    Huwentoxin-IV, voltage-gated Na+ channel inhibitor
  • Description

    Neuronal tetrodotoxin (TTX) -sensitive voltage-gated Na+ channel inhibitor
  • Biological description

    Neuronal tetrodotoxin (TTX) -sensitive voltage-gated Na+ channel inhibitor. IC50 values are 26, 150 and 338 nM for neuronal NaV 1.7, 1.2 and 1.3 respectively and >10 μM for muscle subtypes NaV 1.4 and 1.5. Introduces a significant upgrade to the pain threshold in vivo.
  • Purity

    > 99%
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    4106.00
  • Molecular formula

    C174H278N55O51S6
  • Sequence

    ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI (Modifications: C-terminal amide; Disulfide bonds: 2-17, 9-24, 16-31)
  • Storage instructions

    Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Haplopelma schmidti

  • Research areas

Images

  • Huwentoxin-IV inhibits NaV1.7 channels heterologously expressed in Xenopus oocytes.

    A. Time course of current inhibition by 500 nM Huwentoxin-IV (ab141873) (green). Currents were elicited by a voltage ramp between -80 mV to +20 mV (60 ms) every 10 seconds from holding potential of -80 mV. B. Example traces of current response to voltage ramp application before (black) and during (green) 500 nM Huwentoxin-IV application.

References

This product has been referenced in:

  • Deng M  et al. Synthesis and biological characterization of synthetic analogs of Huwentoxin-IV (Mu-theraphotoxin-Hh2a), a neuronal tetrodotoxin-sensitive sodium channel inhibitor. Toxicon 71:57-65 (2013). Read more (PubMed: 23726857) »
  • Minassian NA  et al. Analysis of the Structural and Molecular Basis of Voltage-sensitive Sodium Channel Inhibition by the Spider Toxin Huwentoxin-IV (µ-TRTX-Hh2a). J Biol Chem 288:22707-20 (2013). Read more (PubMed: 23760503) »
  • Rong M  et al. Native pyroglutamation of huwentoxin-IV: a post-translational modification that increases the trapping ability to the sodium channel. PLoS One 8:e65984 (2013). Read more (PubMed: 23826086) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab141873.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Sign up