Overview

  • Product name

  • Description

    Rabbit polyclonal to HYPE
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human HYPE aa 63-185.
    Sequence:

    SKPDRAQHAATKCTSPSTELSITSRGATLLVAKTKASPAGKLEARAALNQ ALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYL YTRALTISPYHEKALVNRDRTLP


    Database link: Q9BVA6

  • Positive control

    • WB: A549 and HeLa whole cell lysates; Rat kidney lysate. IHC-P: Human small intestine and kidney tissue. ICC/IF: PC-3 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237521 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 52 kDa.
IHC-P 1/500 - 1/1000.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Adenylyltransferase that mediates the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins. Able to inactivate Rho GTPases in vitro by adding AMP to RhoA, Rac and Cdc42. It is however unclear whether it inactivates GTPases in vivo and physiological substrates probably remain to be identified.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the fic family.
    Contains 1 fido domain.
    Contains 2 TPR repeats.
  • Domain

    The fido domain mediates the adenylyltransferase activity.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adenosine monophosphate-protein transferase FICD antibody
    • AMPylator FICD antibody
    • FIC domain containing antibody
    • FIC domain containing protein antibody
    • FIC domain-containing protein antibody
    • Fic S phase protein cell division homolog antibody
    • ficd antibody
    • FICD_HUMAN antibody
    • HIP-13 antibody
    • HIP13 antibody
    • Huntingtin interacting protein 13 antibody
    • Huntingtin interacting protein E antibody
    • Huntingtin interactor protein E antibody
    • Huntingtin yeast partner E antibody
    • Huntingtin-interacting protein 13 antibody
    • Huntingtin-interacting protein E antibody
    • MGC5623 antibody
    • UNQ3041 antibody
    see all

Images

  • All lanes : Anti-HYPE antibody (ab237521) at 1/500 dilution

    Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : Rat kidney tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 52 kDa

  • Paraffin-embedded human small intestine tissue stained for HYPE using ab237521 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human kidney tissue stained for HYPE using ab237521 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • PC-3 (Human prostate adenocarcinoma cell line) cells stained for HYPE (green) using ab237521 at 1/166 dilution in ICC/IF. Secondary antibody is an Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L). The nuclear counter stain is DAPI (blue).

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the antibody overnight at 4°C. 

     

References

ab237521 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237521.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up