Overview

  • Product name

  • Description

    Rabbit polyclonal to IARS2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human IARS2 aa 671-754.
    Sequence:

    NVIHPDVVVNGGQDQSKEPPYGADVLRWWVADSNVFTEVAIGPSVLNAAR DDISKLRNTLRFLLGNVADFNPETDSIPVNDMYV


    Database link: Q9NSE4

  • Positive control

    • IHC-P: Human duodenum tissue. WB: RT4 and U-251 MG sp cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224457 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 114 kDa.

Target

  • Sequence similarities

    Belongs to the class-I aminoacyl-tRNA synthetase family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2010002H18Rik antibody
    • C79125 antibody
    • EC 6.1.1.5 antibody
    • FLJ10326 antibody
    • Iars2 antibody
    • IleRS antibody
    • isoleucine tRNA ligase 2, mitochondrial antibody
    • isoleucine tRNA ligase, mitochondrial antibody
    • isoleucine tRNA synthetase 2, mitochondrial antibody
    • Isoleucine--tRNA ligase antibody
    • isoleucine-tRNA synthetase 2 antibody
    • isoleucyl tRNA synthetase 2, mitochondrial antibody
    • Isoleucyl-tRNA synthetase antibody
    • MGC63429 antibody
    • mitochondrial antibody
    • mitochondrial isoleucine tRNA synthetase antibody
    • rCG_20084 antibody
    • RGD1311857 antibody
    • SYIM_HUMAN antibody
    see all

Images

  • Paraffin-embedded human duodenum tissue stained for IARS2 using ab224457 at 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-IARS2 antibody (ab224457) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 114 kDa

References

ab224457 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224457.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up