For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Explore the power of knock-out cell lines for your research

  1. Link

    iberiotoxin-high-conductance-k-channel-blocker-ab120379.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Biochemicals Product Range Just Add Water
Share by email

Iberiotoxin, high-conductance K+ channel blocker (ab120379)

  • Datasheet
  • SDS
  • COA
Submit a review Submit a question References (5)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Chemical Structure - Iberiotoxin, high-conductance K<sup>+</sup> channel blocker&nbsp; (ab120379)
  • Functional Studies - Iberiotoxin, high-conductance K<sup>+</sup> channel blocker&nbsp; (ab120379)

Key features and details

  • Selective blocker of the high-conductance, Ca2+-activated K+ channel
  • CAS Number: 129203-60-7
  • Soluble in water
  • Form / State: Solid
  • Source: Synthetic

Overview

  • Product name

    Iberiotoxin, high-conductance K+ channel blocker
  • Description

    Selective blocker of the high-conductance, Ca2+-activated K+ channel
  • Biological description

    Selective blocker of the high-conductance, Ca2+-activated K+ channel. Originally isolated from the scorpion Mesobuthus tamulus. Specifically blocks KCa1.1 (Slo) channels (Ki approx. 1 nM).

  • CAS Number

    129203-60-7
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    4230.86
  • Molecular formula

    C179H274N50O55S7
  • Sequence

    XFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ (Modifications: X-1 = Glp; Disulfide bonds: 7-28, 13-33, 17-35)
  • PubChem identifier

    16132435
  • Storage instructions

    Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Toxic, refer to SDS for further information.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Synthetic

  • Research areas

    • Biochemicals
    • Product Range
    • Just Add Water
    • Biochemicals
    • Chemical Type
    • Biochemicals
    • Biochemicals
    • Chemical Type
    • Bioactive peptides
    • Biochemicals
    • Pharmacology
    • Ion Channels
    • Potassium
    • Blockers
    • Biochemicals
    • Research Area
    • Diabetes
    • Potassium
    • Blockers
    • Biochemicals
    • Research Area
    • Heart disease
    • Potassium
    • Blockers
    • Biochemicals
    • Research Area
    • Hypertension
    • Potassium
    • Blockers
    • Biochemicals
    • Research Area
    • Obesity
    • Potassium
    • Blockers
    • Biochemicals
    • Research Area
    • Pain & inflammation
    • Potassium
    • Blockers
    • Biochemicals
    • Research Area
    • Respiratory disease
    • Potassium
    • Blockers
    • Biochemicals
    • Research Area
    • Stroke
    • Potassium
    • Blockers

Images

  • Chemical Structure - Iberiotoxin, high-conductance K<sup>+</sup> channel blocker&nbsp; (ab120379)
    Chemical Structure - Iberiotoxin, high-conductance K+ channel blocker  (ab120379)
    2D chemical structure image of ab120379, Iberiotoxin, high-conductance K+ channel blocker
  • Functional Studies - Iberiotoxin, high-conductance K<sup>+</sup> channel blocker&nbsp; (ab120379)
    Functional Studies - Iberiotoxin, high-conductance K+ channel blocker  (ab120379)

    HEK293 cells plated for 48 hours and then transfected with rat Slo27 for 24 hours. Currents from whole-cell recordings, with 1 µM Ca2+ in the electrode solution. Cells voltage-clamped at -80 mV, with currents activated by 500 ms depolarization to +20 mV. Concentration-inhibition relationship produces an IC50 of 412 pM.

    (Number of experimental determinations shown in brackets).

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download
  • COA

References (5)

Publishing research using ab120379? Please let us know so that we can cite the reference in this datasheet.

ab120379 has been referenced in 5 publications.

  • Luo M  et al. Sanguinarine Rapidly Relaxes Rat Airway Smooth Muscle Cells Dependent on TAS2R Signaling. Biol Pharm Bull 43:1027-1034 (2020). PubMed: 32404582
  • Wang M  et al. Regulation of Spontaneous Contractions in Intact Rat Bladder Strips and the Effects of Hydrogen Peroxide. Biomed Res Int 2018:2925985 (2018). PubMed: 29511675
  • Fleck D  et al. Distinct purinergic signaling pathways in prepubescent mouse spermatogonia. J Gen Physiol 148:253-71 (2016). PubMed: 27574293
  • Umatani C  et al. GnRH suppresses excitability of visual processing neurons in the optic tectum. J Neurophysiol 114:2775-84 (2015). PubMed: 26354319
  • Hartung H  et al. Nitric oxide donors enhance the frequency dependence of dopamine release in nucleus accumbens. Neuropsychopharmacology 36:1811-22 (2011). PubMed: 21508928

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab120379.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.