Overview

  • Product name

  • Description

    Rabbit polyclonal to ICA69
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ICA69 aa 343-481.
    Sequence:

    DELLDMKSEEGACLGPVAGTPEPEGADKDDLLLLSEIFNASSLEEGEFSK EWAAVFGDGQVKEPVPTMALGEPDPKAQTGSGFLPSQLLDQNMKDLQASL QEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELL


    Database link: Q05084

  • Positive control

    • IHC-P: Human heart muscle tissue. WB: Human liver and tonsil lysates; RT4 cell lysate.
  • General notes

    Previously labelled as ICA1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab224400 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 55 kDa.

Target

  • Function

    May play a role in neurotransmitter secretion.
  • Tissue specificity

    Expressed abundantly in pancreas, heart and brain with low levels of expression in lung, kidney, liver and thyroid.
  • Sequence similarities

    Contains 1 AH domain.
  • Cellular localization

    Cytoplasm > cytosol. Golgi apparatus membrane. Cytoplasmic vesicle > secretory vesicle membrane. Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. Predominantly cytosolic. Also exists as a membrane-bound form which has been found associated with synaptic vesicles and also with the Golgi complex and immature secretory granules.
  • Information by UniProt
  • Database links

  • Alternative names

    • 69 kDa islet cell autoantigen antibody
    • Diabetes mellitus type I autoantigen antibody
    • ICA 1 antibody
    • Ica1 antibody
    • ICA69 antibody
    • ICA69_HUMAN antibody
    • ICAp69 antibody
    • Islet cell autoantigen 1 (69kD) antibody
    • Islet cell autoantigen 1 69kDa antibody
    • Islet cell autoantigen 1 antibody
    • Islet cell autoantigen 1 isoform antibody
    • Islet cell autoantigen p69 antibody
    • OTTHUMP00000200933 antibody
    • OTTHUMP00000200934 antibody
    • OTTHUMP00000200941 antibody
    • OTTHUMP00000200993 antibody
    • p69 antibody
    see all

Images

  • Paraffin-embedded human heart muscle tissue stained for ICA69 using ab224400 at 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-ICA69 antibody (ab224400) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate
    Lane 3 : Human plasma (IgG/HSA depleted)
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Performed under reducing conditions.

    Predicted band size: 55 kDa

References

ab224400 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224400.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up