Overview

  • Product name

  • Description

    Rabbit polyclonal to ICA69
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human ICA69 aa 72-121 (N terminal).
    Sequence:

    DLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALC


    Database link: NP_004959

  • Positive control

    • Hela cell lysate
  • General notes

    Previously labelled as ICA1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab81500 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 55 kDa (predicted molecular weight: 55 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    May play a role in neurotransmitter secretion.
  • Tissue specificity

    Expressed abundantly in pancreas, heart and brain with low levels of expression in lung, kidney, liver and thyroid.
  • Sequence similarities

    Contains 1 AH domain.
  • Cellular localization

    Cytoplasm > cytosol. Golgi apparatus membrane. Cytoplasmic vesicle > secretory vesicle membrane. Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. Predominantly cytosolic. Also exists as a membrane-bound form which has been found associated with synaptic vesicles and also with the Golgi complex and immature secretory granules.
  • Information by UniProt
  • Database links

  • Alternative names

    • 69 kDa islet cell autoantigen antibody
    • Diabetes mellitus type I autoantigen antibody
    • ICA 1 antibody
    • Ica1 antibody
    • ICA69 antibody
    • ICA69_HUMAN antibody
    • ICAp69 antibody
    • Islet cell autoantigen 1 (69kD) antibody
    • Islet cell autoantigen 1 69kDa antibody
    • Islet cell autoantigen 1 antibody
    • Islet cell autoantigen 1 isoform antibody
    • Islet cell autoantigen p69 antibody
    • OTTHUMP00000200933 antibody
    • OTTHUMP00000200934 antibody
    • OTTHUMP00000200941 antibody
    • OTTHUMP00000200993 antibody
    • p69 antibody
    see all

Images

  • Anti-ICA69 antibody (ab81500) at 1 µg/ml + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 55 kDa
    Observed band size: 55 kDa

References

This product has been referenced in:

  • Matsunaga K  et al. Rab2a and Rab27a cooperatively regulate the transition from granule maturation to exocytosis through the dual effector Noc2. J Cell Sci 130:541-550 (2017). Read more (PubMed: 27927751) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab81500.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up