Overview

  • Product name

  • Description

    Rabbit polyclonal to ICAD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human ICAD aa 51-305. Expressed in E.coli. N-terminal tags.
    Sequence:

    AIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSD GGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLV DAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALE KEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQA PELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQT QSLHS


    Database link: O00273-1

  • Positive control

    • WB: Recombinant human ICAD protein; Human lung lysate; HeLa, MCF7 and HEK-293T cell lysates. IHC-P: Human stomach, kidney and breast cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 37 kDa.

Target

  • Function

    Inhibitor of the caspase-activated DNase (DFF40).
  • Sequence similarities

    Contains 1 CIDE-N domain.
  • Post-translational
    modifications

    Caspase-3 cleaves DFF45 at 2 sites to generate an active factor.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • A330085O09Rik antibody
    • Caspase activated deoxyribonuclease inhibitor short form antibody
    • DFF 1 antibody
    • DFF 45 antibody
    • DFF alpha antibody
    • DFF-45 antibody
    • DFF1 antibody
    • DFF35 antibody
    • DFF45 antibody
    • DFFA antibody
    • Dffa DNA fragmentation factor, alpha subunit antibody
    • DFFA_HUMAN antibody
    • DNA fragmentation factor 45 kDa subunit antibody
    • DNA Fragmentation Factor Alpha Subunit antibody
    • DNA fragmentation factor subunit alpha antibody
    • DNA fragmentation factor, 45 kD, alpha subunit antibody
    • DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1 antibody
    • DNA fragmentation factor, 45kDa, alpha polypeptide antibody
    • DNA fragmentation factor, alpha subunit antibody
    • DNAation factor 45 kDa subunit antibody
    • H13 antibody
    • ICAD antibody
    • ICAD L antibody
    • ICAD S antibody
    • Inhibitor of CAD antibody
    • Inhibitor of Caspase Activated DNase antibody
    • MGC143066 antibody
    • OTTHUMP00000001903 antibody
    • OTTHUMP00000001904 antibody
    • RP23 121D17.3 antibody
    see all

Images

  • All lanes : Anti-ICAD antibody (ab232957) at 3 µg/ml

    Lane 1 : Human lung lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : MCF7 (human breast adenocarcinoma cell line) cell lysate
    Lane 4 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 37 kDa

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for ICAD using ab232957 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for ICAD using ab232957 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for ICAD using ab232957 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-ICAD antibody (ab232957) at 3 µg + Recombinant human ICAD protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 37 kDa

References

ab232957 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up