Overview

  • Product name

  • Description

    Rabbit polyclonal to ICAD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse ICAD aa 19-262. (Expressed in E.coli).
    Sequence:

    KPCLLRRNHSRDQHGVAASSLEELRSKACELLAIDKSLTPITLVLAEDGT IVDDDDYFLCLPSNTKFVALACNEKWIYNDSDGGTAWVSQESFEADEPDS RAGVKWKNVARQLKEDLSSIILLSEEDLQALIDIPCAELAQELCQSCATV QGLQSTLQQVLDQREEARQSKQLLELYLQALEKEGNILSNQKESKAALSE ELDAVDTGVGREMASEVLLRSQILTTLKEKPAPELSLSSQDLES


    Database link: O54786

  • Positive control

    • WB: Recombinant mouse ICAD protein; Rat spleen lysate; Mouse colon lysate. IHC-P: Mouse lung and stomach tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab233419 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 37 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Inhibitor of the caspase-activated DNase (DFF40).
  • Sequence similarities

    Contains 1 CIDE-N domain.
  • Post-translational
    modifications

    Caspase-3 cleaves DFF45 at 2 sites to generate an active factor.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • A330085O09Rik antibody
    • Caspase activated deoxyribonuclease inhibitor short form antibody
    • DFF 1 antibody
    • DFF 45 antibody
    • DFF alpha antibody
    • DFF-45 antibody
    • DFF1 antibody
    • DFF35 antibody
    • DFF45 antibody
    • DFFA antibody
    • Dffa DNA fragmentation factor, alpha subunit antibody
    • DFFA_HUMAN antibody
    • DNA fragmentation factor 45 kDa subunit antibody
    • DNA Fragmentation Factor Alpha Subunit antibody
    • DNA fragmentation factor subunit alpha antibody
    • DNA fragmentation factor, 45 kD, alpha subunit antibody
    • DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1 antibody
    • DNA fragmentation factor, 45kDa, alpha polypeptide antibody
    • DNA fragmentation factor, alpha subunit antibody
    • DNAation factor 45 kDa subunit antibody
    • H13 antibody
    • ICAD antibody
    • ICAD L antibody
    • ICAD S antibody
    • Inhibitor of CAD antibody
    • Inhibitor of Caspase Activated DNase antibody
    • MGC143066 antibody
    • OTTHUMP00000001903 antibody
    • OTTHUMP00000001904 antibody
    • RP23 121D17.3 antibody
    see all

Images

  • Anti-ICAD antibody (ab233419) at 2 µg/ml + Recombinant mouse ICAD protein

    Predicted band size: 37 kDa

  • Anti-ICAD antibody (ab233419) at 2 µg/ml + Rat spleen lysate

    Predicted band size: 37 kDa

  • Anti-ICAD antibody (ab233419) at 2 µg/ml + Mouse colon lysate

    Predicted band size: 37 kDa

  • Formalin-fixed, paraffin-embedded mouse lung tissue stained for ICAD using ab233419 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse stomach tissue stained for ICAD using ab233419 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab233419 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233419.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up