Overview

  • Product name

    Anti-ICAM2 antibody [6B9G10]
    See all ICAM2 primary antibodies
  • Description

    Mouse monoclonal [6B9G10] to ICAM2
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Recombinant fragment corresponding to Human ICAM2 aa 25-223 (extracellular). Expressed in E.coli.
    Sequence:

    KVFEVHVRPKKLAVEPKGSLEVNCSTTCNQPEVGGLETSLDKILLDEQAQ WKHYLVSNISHDTVLQCHFTCSGKQESMNSNVSVYQPPRQVILTLQPTLV AVGKSFTIECRVPTVEPLDSLTLFLFRGNETLHYETFGKAAPAPQEATAT FNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSAPKMLEIYEPVSDSQ


    Database link: P13598

  • Positive control

    • WB: Recombinant human ICAM2 (AA: extra 25-223) protein; ICAM2 (AA: extra 25-223)-hIgGFc transfected HEK-293 whole cell lysate. Flow: Ramos cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab233828 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/200 - 1/400.
WB 1/500 - 1/2000.

Target

  • Relevance

    ICAM2 is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin like C2 type domains, and bind to the leukocyte adhesion LFA1 protein. This protein may play a role in lymphocyte recirculation by blocking LFA1 dependent cell adhesion. It mediates adhesive interactions important for antigen specific immune response, NK cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance.
  • Cellular localization

    Membrane; Single-pass type I membrane protein
  • Database links

  • Alternative names

    • CD102 antibody
    • CD102 antigen antibody
    • ICAM 2 antibody
    • Intercellular adhesion molecule 2 antibody
    • Ly60 antibody
    see all

Images

  • Anti-ICAM2 antibody [6B9G10] (ab233828) at 1/500 dilution + Recombinant human ICAM2 (AA: extra 25-223) protein.

    Developed using the ECL technique.
  • All lanes : Anti-ICAM2 antibody [6B9G10] (ab233828) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 2 : ICAM2 (AA: extra 25-223)-hIgGFc transfected HEK-293 whole cell lysate

    Developed using the ECL technique.
  • Flow cytometric analysis of Ramos (human Burkitt's lymphoma cell line) cell line labeling ICAM2 with ab233828 at 1/200 dilution (green) compared with a negative control (red).

References

ab233828 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233828.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up