Overview

  • Product name

  • Description

    Rabbit polyclonal to ICAM2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat ICAM2 aa 29-247. Expressed in E.coli. N-terminal tags.
    Sequence:

    VYIRSEKQIVKATEAWRVNCSTSCAAPEIGGLETPTNKLMLEEDPHGKWI EFLVSNATVDTVLLCHFTCSGKQQAESFNIRVYEPPAQVTLKLQPPRVFM GEAFTIECKVPSVKPLESLTLSLLCGRETLKNQTFGGAETVPEEVIAIFN STALKKDGLNFSCQAELDLRPHGGSLYRRISEYQSLEVYEIRQDNQMVII IVVVSILLFLFVTSVLLCF


    Database link: Q6AXM6

  • Positive control

    • IHC-P: Rat liver, stomach, small intestine, heart, lung and adrenal gland tissues. WB: Recombinant rat ICAM2 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231097 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231097 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 31 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    ICAM2 is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin like C2 type domains, and bind to the leukocyte adhesion LFA1 protein. This protein may play a role in lymphocyte recirculation by blocking LFA1 dependent cell adhesion. It mediates adhesive interactions important for antigen specific immune response, NK cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance.
  • Cellular localization

    Membrane; Single-pass type I membrane protein
  • Database links

  • Alternative names

    • CD102 antibody
    • CD102 antigen antibody
    • ICAM 2 antibody
    • Intercellular adhesion molecule 2 antibody
    • Ly60 antibody
    see all

Images

  • Paraffin-embedded rat liver tissue stained for ICAM2 using ab231097 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat stomach tissue stained for ICAM2 using ab231097 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat small intestine tissue stained for ICAM2 using ab231097 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat heart tissue stained for ICAM2 using ab231097 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat lung tissue stained for ICAM2 using ab231097 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat adrenal gland tissue stained for ICAM2 using ab231097 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-ICAM2 antibody (ab231097) at 3 µg/ml + Recombinant rat ICAM2 protein

    Predicted band size: 31 kDa

References

ab231097 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231097.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up