Overview

  • Product name

  • Description

    Rabbit polyclonal to ICAM2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse ICAM2 aa 27-248. (Expressed in E.coli).
    Sequence:

    VYIWSEKQIVEATESWKINCSTNCAAPDMGGLETPTNKIMLEEHPQGKWK QFLVSNVSKDTVFFCHFTCSGKQHSESLNIRVYQPPAQVTLKLQPPRVFV GEDFTIECTVSPVQPLERLTLSLLRGRETLKNQTFGGAETVPQEATATFN STALKKDGLNFSCQAELDLRPHGGYIIRSISEYQILEVYEPMQDNQMVII IVVVSILLFLFVTSVLLCFIFG


    Database link: P35330

  • Positive control

    • WB: Recombinant mouse ICAM2 protein; HeLa cell lysate. IHC-P: Mouse spleen tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231564 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231564 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 31 kDa.

Target

  • Relevance

    ICAM2 is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin like C2 type domains, and bind to the leukocyte adhesion LFA1 protein. This protein may play a role in lymphocyte recirculation by blocking LFA1 dependent cell adhesion. It mediates adhesive interactions important for antigen specific immune response, NK cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance.
  • Cellular localization

    Membrane; Single-pass type I membrane protein
  • Database links

  • Alternative names

    • CD102 antibody
    • CD102 antigen antibody
    • ICAM 2 antibody
    • Intercellular adhesion molecule 2 antibody
    • Ly60 antibody
    see all

Images

  • Anti-ICAM2 antibody (ab231564) at 2 µg/ml + Recombinant mouse ICAM2 protein

    Predicted band size: 31 kDa

  • Anti-ICAM2 antibody (ab231564) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 31 kDa

  • Formalin-fixed, paraffin-embedded mouse spleen tissue stained for ICAM2 using ab231564 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231564 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231564.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up