Overview

  • Product name

  • Description

    Rabbit polyclonal to ICAM5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
  • Immunogen

    Recombinant fragment corresponding to Human ICAM5 aa 409-674. Expressed in E. coli. N-terminal GST-tag and His-tag.
    Sequence:

    RLDDSDCPRSWTWPEGPEQTLRCEARGNPEPSVHCARSDGGAVLALGLLG PVTRALSGTYRCKAANDQGEAVKDVTLTVEYAPALDSVGCPERITWLEGT EASLSCVAHGVPPPDVICVRSGELGAVIEGLLRVAREHAGTYRCEATNPR GSAAKNVAVTVEYGPRFEEPSCPSNWTWVEGSGRLFSCEVDGKPQPSVKC VGSGGATEGVLLPLAPPDPSPRAPRIPRVLAPGIYVCNATNRHGSVAKTV VVSAESPPEMDESTCP


    Database link: Q9UMF0

  • Positive control

    • IHC-P: Human brain tissue. WB: Recombinant human ICAM5 protein. Mouse and pig cerebrum lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232785 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    ICAM5 is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is expressed on the surface of telencephalic neurons and displays two types of adhesion activity, homophilic binding between neurons and heterophilic binding between neurons and leukocytes. It may be a critical component in neuron-microglial cell interactions in the course of normal development or as part of neurodegenerative diseases.
  • Cellular localization

    Membrane; single-pass type I membrane protein
  • Database links

  • Alternative names

    • ICAM5 precursor antibody
    • Intercellular adhesion molecule 5 antibody
    • Intercellular adhesion molecule 5 precursor antibody
    • Intercellular adhesion molecule 5, telencephalin antibody
    • Telencephalin antibody
    • TLCN antibody
    • TLN antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human brain tissue stained for ICAM5 with ab232785 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-ICAM5 antibody (ab232785) at 1 µg/ml + Mouse cerebrum lysate
  • Anti-ICAM5 antibody (ab232785) at 1 µg/ml + Pig cerebrum lysate
  • Anti-ICAM5 antibody (ab232785) at 2 µg/ml + Recombinant human ICAM5 protein

References

ab232785 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232785.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up