Overview

  • Product name

    Anti-ICE1 antibody
  • Description

    Rabbit polyclonal to ICE1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human ICE1 aa 1213-1505.
    Sequence:

    SEIGEKYRKQPCEEETLGTCEEWIESEEDDYSLKNTSQLTQCSLETLSEV LTKIRQELQTNSEDCNGKDTGSLLLLNVNNNMTTENLKEKSPFRETTGSS SHASEPTPQAAALDTEGSSPISGMPQNENPQSRPEARSDAGRQTDGGEED LPEPVEPSALCSDSVMEPSIEQSSNCEAETTFQCQIATVTSEVINVLINK DQNLVIEKGDNWTIISGVAVLPHVDQVTLCDIPGDIPISQDQGELEAGCI PVTSAEKSPEASHTGPAFQEAPCGNNLSCPQEDVSSSGQSTNF


    Database link: Q9Y2F5

  • Positive control

    • WB: Mouse brain tissue lysate. IHC: Human thyroid and adrenal gland tissue.
  • General notes

     This product was previously labelled as KIAA0947

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab222889 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human thyroid tissue stained for ICE1 using ab222889 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for ICE1 using ab222889 at 1/100 dilution in immunohistochemical analysis.

  • Anti-ICE1 antibody (ab222889) at 1/500 dilution + Mouse brain tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

References

ab222889 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222889.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up