Overview

  • Product name

  • Description

    Rabbit polyclonal to ICK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ICK aa 286-404.
    Sequence:

    VGHPLGSTTQNLQDSEKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISS RQHQASQPPLHLTYPYKAEVSRTDHPSHLQEDKPSPLLFPSLHNKHPQSK ITAGLEHKNGEIKPKSRRR


    Database link: Q9UPZ9

  • Positive control

    • IHC-P: Human colon tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224220 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    ICK may play a key role in the development of multiple organ systems and particularly in cardiac development.
  • Cellular localization

    Cytoplasmic and Nuclear
  • Database links

  • Alternative names

    • 2210420N10Rik antibody
    • AI848300 antibody
    • ECO antibody
    • Heart serine threonine protein kinase antibody
    • hICK antibody
    • Intestinal cell (MAK like) kinase antibody
    • Intestinal cell kinase antibody
    • KIAA0936 antibody
    • Laryngeal cancer kinase 2 antibody
    • LCK2 antibody
    • MAK related kinase antibody
    • MGC46090 antibody
    • mICK antibody
    • MRK antibody
    • OTTMUSP00000041856 antibody
    • OTTMUSP00000041857 antibody
    • Serine/threonine protein kinase ICK antibody
    see all

Images

  • Paraffin-embedded human colon tissue stained for ICK using ab224220 at 1/50 dilution in immunohistochemical analysis.

References

ab224220 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224220.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up