Overview

  • Product name

  • Description

    Rabbit polyclonal to Id1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human Id1 aa 55-105 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    ALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRD L


    Database link: P41134

  • Positive control

    • Rat brain, mouse lymphoma and human colon carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203202 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Use at 1/50 - 1/200 with fluorescent detection methods.

Target

  • Function

    ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Developmental stage

    Expression correlates with proliferation in some types of cells.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • bHLHb24 antibody
    • Class B basic helix-loop-helix protein 24 antibody
    • dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helix protein) antibody
    • DNA binding protein inhibitor ID 1 antibody
    • DNA binding protein inhibitor ID1 antibody
    • DNA-binding protein inhibitor ID-1 antibody
    • Dominant negative helix loop helix protein antibody
    • ID 1 antibody
    • ID antibody
    • ID1 antibody
    • ID1_HUMAN antibody
    • Inhibitor of Differentiation 1 antibody
    • Inhibitor of DNA binding 1 antibody
    • inhibitor of DNA binding 1, dominant negative helix-loop-helix protein antibody
    see all

Images

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded human colon carcinoma tissue sections labeling Id1 with ab203202 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded mouse lymphoma tissue sections labeling Id1 with ab203202 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded rat brain tissue sections labeling Id1 with ab203202 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203202 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Western blot
Sample
Chicken Cell lysate - whole cell (fibroblast)
Gel Running Conditions
Reduced Denaturing (ProteinSimple)
Loading amount
10 µg
Specification
fibroblast
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 20°C

Abcam user community

Verified customer

Submitted May 05 2017

Application
Immunocytochemistry/ Immunofluorescence
Sample
Chicken Cell (fibroblast)
Permeabilization
Yes - 0.05% Triton
Specification
fibroblast
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 20°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted May 05 2017

Application
Western blot
Sample
Human Cell lysate - whole cell (293T)
Gel Running Conditions
Reduced Denaturing (ProteinSimple)
Loading amount
10 µg
Specification
293T
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 20°C

Abcam user community

Verified customer

Submitted May 05 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up