Overview

  • Product name

    Anti-ID2 antibody [OTI10C3]
    See all ID2 primary antibodies
  • Description

    Mouse monoclonal [OTI10C3] to ID2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human ID2 aa 1-134. Protein expressed in E.coli. NP_002157
    Sequence:

    MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELV PSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASR TPLTTLNTDISILSLQASEFPSELMSNDSKALCG


    Database link: Q02363

  • Positive control

    • IHC-P: Human liver, bladder carcinoma and liver carcinoma tissue. ICC/IF: HeLa cells. WB: pCMV6-ENTRY ID2 cDNA transfected HEK-293T cell lysate. FC: SH-SY5Y cells.
  • General notes

    The clone number has been updated from 10C3 to OTI10C3, both clone numbers name the same clone.

Properties

Applications

Our Abpromise guarantee covers the use of ab90055 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500. Predicted molecular weight: 15 kDa.
IHC-P 1/50. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
ICC/IF 1/50.
Flow Cyt Use at an assay dependent concentration.

Target

  • Function

    ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. ID-2 may be an inhibitor of tissue-specific gene expression.
  • Tissue specificity

    Highly expressed in early fetal tissues, including those of the central nervous system.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Developmental stage

    Found in most early fetal tissues but not in the corresponding mature tissues.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • bHLHb26 antibody
    • Cell growth inhibiting gene 8 antibody
    • class B basic helix loop helix protein 26 antibody
    • Class B basic helix-loop-helix protein 26 antibody
    • DNA binding protein inhibitor ID 2 antibody
    • DNA binding protein inhibitor ID2 antibody
    • DNA-binding protein inhibitor ID-2 antibody
    • GIG 8 antibody
    • GIG8 antibody
    • Helix loop helix protein ID2 antibody
    • ID2 antibody
    • ID2_HUMAN antibody
    • ID2A antibody
    • ID2H antibody
    • Inhibitor of differentiation 2 antibody
    • Inhibitor of DNA binding 2 antibody
    • Inhibitor of DNA binding 2, dominant negative helix loop helix protein antibody
    • MGC26389 antibody
    see all

Images

  • All lanes : Anti-ID2 antibody [OTI10C3] (ab90055) at 1/500 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells were transfected with the pCMV6-ENTRY control
    Lane 2 : HEK-293T cells were transfected with the pCMV6-ENTRY ID2 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 15 kDa

  • Paraffin-embedded human bladder carcinoma tissue stained for ID2 with ab90055 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for ID2 using ab90055 at a 1/50 dilution in ICC/IF.

  • Paraffin-embedded human liver tissue stained for ID2 with ab90055 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.

  • Paraffin-embedded human liver carcinoma tissue stained for ID2 with ab90055 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.

  • Overlay histogram showing SH-SY5Y cells stained with ab90055 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab90055, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2b [PLPV219] (ab91366, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in SH-SY5Y cells fixed with 80% methanol (5 min)/permeabilized with 0.1% PBS-Tween for 20 min used under the same conditions.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab90055.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up