Overview

  • Product name

    Anti-ID2 antibody [OTI9A8]
    See all ID2 primary antibodies
  • Description

    Mouse monoclonal [OTI9A8] to ID2
  • Host species

    Mouse
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human ID2 aa 1-134. (NP_002157) produced in E.coli.
    Sequence:

    MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELV PSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASR TPLTTLNTDISILSLQASEFPSELMSNDSKALCG


    Database link: Q02363

  • Positive control

    • WB: HEK-293T transfected with pCMV6-ENTRY ID2 whole cell lysate. IHC-P: Human liver carcinoma tissue. ICC/IF: COS-7 cells transiently transfected with pCMV6-ENTRY ID2.
  • General notes

    Clone OTI9A8 (formerly 9A8).

Properties

Applications

Our Abpromise guarantee covers the use of ab236504 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/100.
IHC-P 1/50.

Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes

WB 1/500. Predicted molecular weight: 14 kDa.

Target

  • Function

    ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. ID-2 may be an inhibitor of tissue-specific gene expression.
  • Tissue specificity

    Highly expressed in early fetal tissues, including those of the central nervous system.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Developmental stage

    Found in most early fetal tissues but not in the corresponding mature tissues.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • bHLHb26 antibody
    • Cell growth inhibiting gene 8 antibody
    • class B basic helix loop helix protein 26 antibody
    • Class B basic helix-loop-helix protein 26 antibody
    • DNA binding protein inhibitor ID 2 antibody
    • DNA binding protein inhibitor ID2 antibody
    • DNA-binding protein inhibitor ID-2 antibody
    • GIG 8 antibody
    • GIG8 antibody
    • Helix loop helix protein ID2 antibody
    • ID2 antibody
    • ID2_HUMAN antibody
    • ID2A antibody
    • ID2H antibody
    • Inhibitor of differentiation 2 antibody
    • Inhibitor of DNA binding 2 antibody
    • Inhibitor of DNA binding 2, dominant negative helix loop helix protein antibody
    • MGC26389 antibody
    see all

Images

  • All lanes : Anti-ID2 antibody [OTI9A8] (ab236504) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY control, cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY ID2, cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 14 kDa

  • Paraffin-embedded human liver carcinoma tissue stained for ID2 using ab236504 at 1/50 dilution in immunohistochemical analysis.

  • COS-7 (African green monkey kidney fibroblast-like cell line) cells transiently transfected with pCMV6-ENTRY ID2 stained for ID2 (green) using ab236504 at 1/100 dilution in ICC/IF.

References

ab236504 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236504.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up