Overview

  • Product name

    Anti-ID3 antibody [OTI8B3]
    See all ID3 primary antibodies
  • Description

    Mouse monoclonal [OTI8B3] to ID3
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog
  • Immunogen

    Recombinant full length protein corresponding to Human ID3 aa 1-119. (NP_002158) produced in HEK-293T cells.
    Sequence:

    MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSR LRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQ TAELTPELVISNDKRSFCH


    Database link: Q02535

  • Positive control

    • WB: HEK-293T transfected with pCMV6-ENTRY ID3 cDNA, whole cell lysate. IHC-P: Human colon, kidney, liver, ovary, thyroid and prostate tissue. ICC/IF: COS-7 cells transiently transfected with pCMV6-ENTRY ID3 cDNA. Flow: HeLa and Jurkat cells.
  • General notes

    Clone OTI8B3 (formerly 8B3).

Properties

Applications

Our Abpromise guarantee covers the use of ab236505 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50.

Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.

WB 1/500. Predicted molecular weight: 13 kDa.
ICC/IF 1/100.
Flow Cyt 1/100.

Target

  • Function

    ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. ID-3 inhibits the binding of E2A-containing protein complexes to muscle creatine kinase E-box enhancer. May inhibit other transcription factors.
  • Tissue specificity

    Expressed abundantly in lung, kidney and adrenal gland, but not in adult brain.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1R21 antibody
    • bHLHb25 antibody
    • Class B basic helix-loop-helix protein 25 antibody
    • DNA binding protein inhibitor ID 3 antibody
    • DNA-binding protein inhibitor ID-3 antibody
    • HEIR 1 antibody
    • HEIR1 antibody
    • Helix loop helix protein HEIR 1 antibody
    • Helix loop helix protein HEIR1 antibody
    • Helix-loop-helix protein HEIR-1 antibody
    • HLH642 antibody
    • ID 3 antibody
    • ID like protein inhibitor HLH 1R21 antibody
    • ID like protein inhibitor HLH 462 antibody
    • ID-like protein inhibitor HLH 1R21 antibody
    • ID3 antibody
    • ID3_HUMAN antibody
    • Inhibitor of DNA binding 3 antibody
    • Inhibitor of DNA binding 3 dominant negative helix loop helix protein antibody
    see all

Images

  • All lanes : Anti-ID3 antibody [OTI8B3] (ab236505) at 1/500 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY control cDNA, whole cell lysate
    Lane 2 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY ID3 cDNA, whole cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 13 kDa

  • Paraffin-embedded human colon tissue stained for ID3 using ab236505 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for ID3 using ab236505 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for ID3 using ab236505 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human ovary tissue stained for ID3 using ab236505 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human thyroid tissue stained for ID3 using ab236505 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate tissue stained for ID3 using ab236505 at 1/50 dilution in immunohistochemical analysis.

  • COS-7 (African green monkey kidney fibroblast-like cell line) cells transiently transfected with pCMV6-ENTRY ID3 cDNA stained for ID3 (green) using ab236505 at 1/100 dilution in ICC/IF.

  • Flow cytometric analysis of HeLa (Human epithelial cell line from cervix adenocarcinoma) cells labeling ID3 with ab236505 at 1/100 dilution (red) compared to a negative control antibody (blue).

  • Flow cytometric analysis of Jurkat (Human T cell leukemia cell line from peripheral blood) cells labeling ID3 with ab236505 at 1/100 dilution (red) compared to a negative control antibody (blue).

References

ab236505 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236505.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up