Overview

  • Product name

  • Description

    Rabbit polyclonal to IDH1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
    Predicted to work with: Rat, Sheep, Cow, Orangutan, Prairie vole
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human IDH1 aa 74-333. N-Terminal tag. (Expressed in E.coli).
    Sequence:

    ATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSG WVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFE EGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRF KDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYD GDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQ ETSTNPIASI


    Database link: O75874

  • Positive control

    • IHC-P: Human liver tissue. WB: Recombinant human IDH1 protein; Mouse, pig and human liver lysate; HepG2 cell lysate.
  • General notes

     This product was previously labelled as Isocitrate dehydrogenase

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233202 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 46 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Involvement in disease

    Glioma
    Genetic variations are associated with cartilaginous tumors such as enchondroma or chondrosarcoma. Mutations of Arg-132 to Cys, Gly or His abolish the conversion of isocitrate to alpha-ketoglutarate. Instead, alpha-ketoglutarate is converted to R(-)-2-hydroxyglutarate.
  • Sequence similarities

    Belongs to the isocitrate and isopropylmalate dehydrogenases family.
  • Post-translational
    modifications

    Acetylation at Lys-374 dramatically reduces catalytic activity.
  • Cellular localization

    Cytoplasm. Peroxisome.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cytosolic NADP isocitrate dehydrogenase antibody
    • Cytosolic NADP-isocitrate dehydrogenase antibody
    • Epididymis luminal protein 216 antibody
    • Epididymis secretory protein Li 26 antibody
    • HEL-216 antibody
    • HEL-S-26 antibody
    • ICDH antibody
    • IDCD antibody
    • IDH antibody
    • IDH1 antibody
    • IDHC_HUMAN antibody
    • IDP antibody
    • IDPC antibody
    • Isocitrate dehydrogenase (NADP(+)) 1 cytosolic antibody
    • Isocitrate dehydrogenase [NADP] cytoplasmic antibody
    • Isocitrate dehydrogenase 1 (NADP+) soluble antibody
    • NADP dependent isocitrate dehydrogenase cytosolic antibody
    • NADP dependent isocitrate dehydrogenase peroxisomal antibody
    • NADP(+)-specific ICDH antibody
    • Oxalosuccinate decarboxylase antibody
    • PICD antibody
    see all

Images

  • All lanes : Anti-IDH1 antibody (ab233202) at 2 µg/ml

    Lane 1 : Mouse liver tissue lysate.
    Lane 2 : Human liver tissue lysate.
    Lane 3 : Pig liver tissue lysate.
    Lane 4 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate.

    Predicted band size: 46 kDa

  • Anti-IDH1 antibody (ab233202) at 2 µg/ml + Recombinant human IDH1 protein.

    Predicted band size: 46 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for IDH1 using ab233202 at 20µg/mL in immunohistochemical analysis.

References

ab233202 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233202.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up