For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    idh1-antibody-c12-ab239606.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Metabolism Energy Metabolism
Share by email

Anti-IDH1 antibody [C12] (ab239606)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-IDH1 antibody [C12] (ab239606)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
  • Western blot - Anti-IDH1 antibody [C12] (ab239606)

Key features and details

  • Mouse monoclonal [C12] to IDH1
  • Suitable for: WB, IHC-P
  • Reacts with: Human, Pig
  • Isotype: IgG2a

You may also be interested in

Protein
Product image
Recombinant human IDH1 (mutated R132H) protein (ab198123)
Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-IDH1 antibody [C12]
    See all IDH1 primary antibodies
  • Description

    Mouse monoclonal [C12] to IDH1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Sheep, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human IDH1 aa 74-333. N-terminal His tag. Expressed in E. coli.
    Sequence:

    ATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSG WVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFE EGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRF KDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYD GDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQ ETSTNPIASI


    Database link: O75874
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Recombinant human IDH1 protein. Human and pig liver tissue lysate. IHC-P: Human stomach, prostate, glioma and kidney tissue.
  • General notes

     This product was previously labelled as Isocitrate dehydrogenase

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    C12
  • Isotype

    IgG2a
  • Light chain type

    kappa
  • Research areas

    • Signal Transduction
    • Metabolism
    • Energy Metabolism
    • Cancer
    • Cancer Metabolism
    • Metabolic signaling pathway
    • Metabolism of lipids and lipoproteins
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Lipid and lipoprotein metabolism
    • Lipid metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Energy transfer pathways
    • Energy Metabolism

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG2a, kappa monoclonal [MG2a-53] - Isotype control (ab18415)
  • Recombinant Protein

    • Recombinant human IDH1 (mutated R132H) protein (ab198123)
  • Related Products

    • Recombinant human IDH1 protein (ab113858)
    • Recombinant human IDH1 protein (ab198096)

Applications

Our Abpromise guarantee covers the use of ab239606 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 47 kDa.
IHC-P Use a concentration of 5 - 30 µg/ml.

Target

  • Involvement in disease

    Glioma
    Genetic variations are associated with cartilaginous tumors such as enchondroma or chondrosarcoma. Mutations of Arg-132 to Cys, Gly or His abolish the conversion of isocitrate to alpha-ketoglutarate. Instead, alpha-ketoglutarate is converted to R(-)-2-hydroxyglutarate.
  • Sequence similarities

    Belongs to the isocitrate and isopropylmalate dehydrogenases family.
  • Post-translational
    modifications

    Acetylation at Lys-374 dramatically reduces catalytic activity.
  • Cellular localization

    Cytoplasm. Peroxisome.
  • Target information above from: UniProt accession O75874 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 281235 Cow
    • Entrez Gene: 3417 Human
    • Entrez Gene: 15926 Mouse
    • Entrez Gene: 100171634 Orangutan
    • Entrez Gene: 102166364 Pig
    • Entrez Gene: 24479 Rat
    • Entrez Gene: 443257 Sheep
    • Omim: 147700 Human
    • SwissProt: Q9XSG3 Cow
    • SwissProt: O75874 Human
    • SwissProt: O88844 Mouse
    • SwissProt: Q5R9C5 Orangutan
    • SwissProt: P20304 Pig
    • SwissProt: P41562 Rat
    • SwissProt: Q6XUZ5 Sheep
    • Unigene: 593422 Human
    • Unigene: 9925 Mouse
    • Unigene: 3561 Rat
    see all
  • Alternative names

    • Cytosolic NADP isocitrate dehydrogenase antibody
    • Cytosolic NADP-isocitrate dehydrogenase antibody
    • Epididymis luminal protein 216 antibody
    • Epididymis secretory protein Li 26 antibody
    • HEL-216 antibody
    • HEL-S-26 antibody
    • ICDH antibody
    • IDCD antibody
    • IDH antibody
    • IDH1 antibody
    • IDHC_HUMAN antibody
    • IDP antibody
    • IDPC antibody
    • Isocitrate dehydrogenase (NADP(+)) 1 cytosolic antibody
    • Isocitrate dehydrogenase [NADP] cytoplasmic antibody
    • Isocitrate dehydrogenase 1 (NADP+) soluble antibody
    • NADP dependent isocitrate dehydrogenase cytosolic antibody
    • NADP dependent isocitrate dehydrogenase peroxisomal antibody
    • NADP(+)-specific ICDH antibody
    • Oxalosuccinate decarboxylase antibody
    • PICD antibody
    see all

Images

  • Western blot - Anti-IDH1 antibody [C12] (ab239606)
    Western blot - Anti-IDH1 antibody [C12] (ab239606)
    All lanes : Anti-IDH1 antibody [C12] (ab239606) at 3 µg/ml

    Lane 1 : Human liver tissue lysate
    Lane 2 : Pig liver tissue lysate

    Secondary
    All lanes : HRP-Rabbit Anti-Mouse IgG at 1/5000 dilution

    Predicted band size: 47 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)

    Formalin-fixed, paraffin-embedded human stomach tissue stained for IDH1 with ab239606 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)

    Formalin-fixed, paraffin-embedded human kidney tissue stained for IDH1 with ab239606 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)

    Formalin-fixed, paraffin-embedded human glioma tissue stained for IDH1 with ab239606 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)

    Formalin-fixed, paraffin-embedded human prostate tissue stained for IDH1 with ab239606 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Western blot - Anti-IDH1 antibody [C12] (ab239606)
    Western blot - Anti-IDH1 antibody [C12] (ab239606)
    Anti-IDH1 antibody [C12] (ab239606) at 5 µg/ml + Recombinant human IDH1 protein

    Predicted band size: 47 kDa

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab239606? Please let us know so that we can cite the reference in this datasheet.

    ab239606 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab239606.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.