Anti-IDH1 antibody [C12] (ab239606)

Submit a review Submit a question
Western blot - Anti-IDH1 antibody [C12] (ab239606)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
  • Western blot - Anti-IDH1 antibody [C12] (ab239606)

Key features and details

  • Mouse monoclonal [C12] to IDH1
  • Suitable for: WB, IHC-P
  • Reacts with: Human, Pig
  • Isotype: IgG2a

Overview

  • Product name

    Anti-IDH1 antibody [C12]
    See all IDH1 primary antibodies

  • Description

    Mouse monoclonal [C12] to IDH1

  • Host species

    Mouse

  • Tested applications

    Suitable for: WB, IHC-Pmore details

  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Sheep, Cow, Orangutan

  • Immunogen

    Recombinant fragment corresponding to Human IDH1 aa 74-333. N-terminal His tag. Expressed in E. coli.
    Sequence:

    ATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSG WVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFE EGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRF KDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYD GDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQ ETSTNPIASI


    Database link: O75874
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • WB: Recombinant human IDH1 protein. Human and pig liver tissue lysate. IHC-P: Human stomach, prostate, glioma and kidney tissue.

  • General notes

     This product was previously labelled as Isocitrate dehydrogenase

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Applications

Our Abpromise guarantee covers the use of ab239606 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 47 kDa.
IHC-P Use a concentration of 5 - 30 µg/ml.

Target

  • Involvement in disease

    Glioma
    Genetic variations are associated with cartilaginous tumors such as enchondroma or chondrosarcoma. Mutations of Arg-132 to Cys, Gly or His abolish the conversion of isocitrate to alpha-ketoglutarate. Instead, alpha-ketoglutarate is converted to R(-)-2-hydroxyglutarate.

  • Sequence similarities

    Belongs to the isocitrate and isopropylmalate dehydrogenases family.

  • Post-translational
    modifications

    Acetylation at Lys-374 dramatically reduces catalytic activity.

  • Cellular localization

    Cytoplasm. Peroxisome.
  • Information by UniProt

  • Database links

    see all

  • Alternative names

    • Cytosolic NADP isocitrate dehydrogenase antibody
    • Cytosolic NADP-isocitrate dehydrogenase antibody
    • Epididymis luminal protein 216 antibody
    • Epididymis secretory protein Li 26 antibody
    • HEL-216 antibody
    • HEL-S-26 antibody
    • ICDH antibody
    • IDCD antibody
    • IDH antibody
    • IDH1 antibody
    • IDHC_HUMAN antibody
    • IDP antibody
    • IDPC antibody
    • Isocitrate dehydrogenase (NADP(+)) 1 cytosolic antibody
    • Isocitrate dehydrogenase [NADP] cytoplasmic antibody
    • Isocitrate dehydrogenase 1 (NADP+) soluble antibody
    • NADP dependent isocitrate dehydrogenase cytosolic antibody
    • NADP dependent isocitrate dehydrogenase peroxisomal antibody
    • NADP(+)-specific ICDH antibody
    • Oxalosuccinate decarboxylase antibody
    • PICD antibody
    see all

Images

  • Western blot - Anti-IDH1 antibody [C12] (ab239606)
    Western blot - Anti-IDH1 antibody [C12] (ab239606)
    All lanes : Anti-IDH1 antibody [C12] (ab239606) at 3 µg/ml

    Lane 1 : Human liver tissue lysate
    Lane 2 : Pig liver tissue lysate

    Secondary
    All lanes : HRP-Rabbit Anti-Mouse IgG at 1/5000 dilution

    Predicted band size: 47 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)

    Formalin-fixed, paraffin-embedded human stomach tissue stained for IDH1 with ab239606 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)

    Formalin-fixed, paraffin-embedded human kidney tissue stained for IDH1 with ab239606 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)

    Formalin-fixed, paraffin-embedded human glioma tissue stained for IDH1 with ab239606 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)

    Formalin-fixed, paraffin-embedded human prostate tissue stained for IDH1 with ab239606 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Western blot - Anti-IDH1 antibody [C12] (ab239606)
    Western blot - Anti-IDH1 antibody [C12] (ab239606)
    Anti-IDH1 antibody [C12] (ab239606) at 5 µg/ml + Recombinant human IDH1 protein

    Predicted band size: 47 kDa

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

References (0)

Publishing research using ab239606? Please let us know so that we can cite the reference in this datasheet.

ab239606 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab239606.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com