Anti-IDH1 antibody [C12] (ab239606)
Key features and details
- Mouse monoclonal [C12] to IDH1
- Suitable for: WB, IHC-P
- Reacts with: Human, Pig
- Isotype: IgG2a
Overview
-
Product name
Anti-IDH1 antibody [C12]
See all IDH1 primary antibodies -
Description
Mouse monoclonal [C12] to IDH1 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human, Pig
Predicted to work with: Mouse, Rat, Sheep, Cow, Orangutan -
Immunogen
Recombinant fragment corresponding to Human IDH1 aa 74-333. N-terminal His tag. Expressed in E. coli.
Sequence:ATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSG WVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFE EGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRF KDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYD GDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQ ETSTNPIASI
Database link: O75874 -
Positive control
- WB: Recombinant human IDH1 protein. Human and pig liver tissue lysate. IHC-P: Human stomach, prostate, glioma and kidney tissue.
-
General notes
This product was previously labelled as Isocitrate dehydrogenase
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A/G purified -
Purification notes
Purified from TCS. -
Clonality
Monoclonal -
Clone number
C12 -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab239606 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 47 kDa. | |
IHC-P | Use a concentration of 5 - 30 µg/ml. |
Target
-
Involvement in disease
Glioma
Genetic variations are associated with cartilaginous tumors such as enchondroma or chondrosarcoma. Mutations of Arg-132 to Cys, Gly or His abolish the conversion of isocitrate to alpha-ketoglutarate. Instead, alpha-ketoglutarate is converted to R(-)-2-hydroxyglutarate. -
Sequence similarities
Belongs to the isocitrate and isopropylmalate dehydrogenases family. -
Post-translational
modificationsAcetylation at Lys-374 dramatically reduces catalytic activity. -
Cellular localization
Cytoplasm. Peroxisome. - Information by UniProt
-
Database links
- Entrez Gene: 281235 Cow
- Entrez Gene: 3417 Human
- Entrez Gene: 15926 Mouse
- Entrez Gene: 100171634 Orangutan
- Entrez Gene: 102166364 Pig
- Entrez Gene: 24479 Rat
- Entrez Gene: 443257 Sheep
- Omim: 147700 Human
see all -
Alternative names
- Cytosolic NADP isocitrate dehydrogenase antibody
- Cytosolic NADP-isocitrate dehydrogenase antibody
- Epididymis luminal protein 216 antibody
see all
Images
-
All lanes : Anti-IDH1 antibody [C12] (ab239606) at 3 µg/ml
Lane 1 : Human liver tissue lysate
Lane 2 : Pig liver tissue lysate
Secondary
All lanes : HRP-Rabbit Anti-Mouse IgG at 1/5000 dilution
Predicted band size: 47 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
Formalin-fixed, paraffin-embedded human stomach tissue stained for IDH1 with ab239606 at 30 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
Formalin-fixed, paraffin-embedded human kidney tissue stained for IDH1 with ab239606 at 30 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
Formalin-fixed, paraffin-embedded human glioma tissue stained for IDH1 with ab239606 at 30 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH1 antibody [C12] (ab239606)
Formalin-fixed, paraffin-embedded human prostate tissue stained for IDH1 with ab239606 at 30 µg/ml in immunohistochemical analysis. DAB staining.
-
Anti-IDH1 antibody [C12] (ab239606) at 5 µg/ml + Recombinant human IDH1 protein
Predicted band size: 47 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab239606 has not yet been referenced specifically in any publications.