Overview

  • Product name

  • Description

    Rabbit polyclonal to IDH2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human IDH2 aa 40-452.
    Sequence:

    DKRIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRD QTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIR NILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAG TFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAI QKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLI DDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGK TIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQD LIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDT IKSNLDRALGRQ


    Database link: P48735

  • Positive control

    • IHC-P: Human stomach, kidney, glioma, liver cancer, prostate, and liver tissue. WB: Recombinant human IDH2 protein; Human lung lysate; Jurkat lysate; Pig heart and liver lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab233446 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 51 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Plays a role in intermediary metabolism and energy production. It may tightly associate or interact with the pyruvate dehydrogenase complex.
  • Involvement in disease

    D-2-hydroxyglutaric aciduria 2
    Glioma
    enetic variations are associated with cartilaginous tumors such as enchondroma or chondrosarcoma.
  • Sequence similarities

    Belongs to the isocitrate and isopropylmalate dehydrogenases family.
  • Post-translational
    modifications

    Acetylation at Lys-413 dramatically reduces catalytic activity. Deacetylated by SIRT3.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • D2HGA2 antibody
    • ICD-M antibody
    • IDH antibody
    • IDH2 antibody
    • IDHM antibody
    • IDHP_HUMAN antibody
    • IDP antibody
    • IDPM antibody
    • Isocitrate dehydrogenase [NADP], mitochondrial antibody
    • Isocitrate dehydrogenase 2 (NADP+), mitochondrial antibody
    • mNADP-IDH antibody
    • NADP(+)-specific ICDH antibody
    • Oxalosuccinate decarboxylase antibody
    see all

Images

  • All lanes : Anti-IDH2 antibody (ab233446) at 1 µg/ml

    Lane 1 : Human lung tissue lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) cell
    lysate
    Lane 3 : Pig heart tissue lysate
    Lane 4 : Pig liver tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 51 kDa

  • Anti-IDH2 antibody (ab233446) at 2 µg/ml + Recombinant human IDH2 protein.

    Predicted band size: 51 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for IDH2 using ab233446 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for IDH2 using ab233446 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for IDH2 using ab233446 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for IDH2 using ab233446 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for IDH2 using ab233446 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for IDH2 using ab233446 at 20µg/mL in immunohistochemical analysis. DAB staining.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233446.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up