Anti-IDH3B antibody (ab247089)
Key features and details
- Rabbit polyclonal to IDH3B
- Suitable for: IHC-P, ICC/IF, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-IDH3B antibody
See all IDH3B primary antibodies -
Description
Rabbit polyclonal to IDH3B -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IF, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rat, Cow, Cynomolgus monkey, Orangutan -
Immunogen
Recombinant fragment corresponding to Human IDH3B aa 67-157.
Sequence:VKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIH TPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNN
Database link: O43837 -
Positive control
- IHC-P: Human parathyroid gland, pancreas, kidney, placenta and testis tissue. WB: RT4 and U-251 MG cell lysates; Human tonsil lysate. ICC/IF: A549 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab247089 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 42 kDa. |
Target
-
Involvement in disease
Defects in IDH3B are the cause of retinitis pigmentosa type 46 (RP46) [MIM:612572]. RP is a retinal dystrophy belonging to the group of pigmentary retinopathies. RP is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. -
Sequence similarities
Belongs to the isocitrate and isopropylmalate dehydrogenases family. -
Cellular localization
Mitochondrion. - Information by UniProt
-
Database links
- Entrez Gene: 613338 Cow
- Entrez Gene: 102129545 Cynomolgus monkey
- Entrez Gene: 3420 Human
- Entrez Gene: 100172344 Orangutan
- Entrez Gene: 94173 Rat
- Omim: 604526 Human
- SwissProt: O77784 Cow
- SwissProt: Q28479 Cynomolgus monkey
see all -
Alternative names
- FLJ11043 antibody
- H-IDHB antibody
- Idh3B antibody
see all
Images
-
PFA-fixed, Triton X-100 permeabilized A549 (human lung carcinoma cell line) cells stained for IDH3B (green) using ab247089 at 4 µg/ml in ICC/IF.
-
All lanes : Anti-IDH3B antibody (ab247089) at 0.4 µg/ml
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (human rain glioma cell line) cell lysate
Lane 3 : Human plasma (IgG/HSA depleted)
Lane 4 : Human liver lysate
Lane 5 : Human tonsil lysate
Predicted band size: 42 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH3B antibody (ab247089)
Formalin-fixed, paraffin-embedded human testis tissue stained for IDH3B with ab247089 at a 1/2500 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH3B antibody (ab247089)
Formalin-fixed, paraffin-embedded human kidney tissue stained for IDH3B with ab247089 at a 1/2500 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH3B antibody (ab247089)
Formalin-fixed, paraffin-embedded human pancreas tissue stained for IDH3B with ab247089 at a 1/2500 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH3B antibody (ab247089)
Formalin-fixed, paraffin-embedded human placenta tissue stained for IDH3B with ab247089 at a 1/2500 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH3B antibody (ab247089)
Formalin-fixed, paraffin-embedded human parathyroid gland tissue stained for IDH3B with ab247089 at a 1/2500 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab247089 has not yet been referenced specifically in any publications.