Overview

  • Product name

  • Description

    Rabbit polyclonal to IDH3G
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human IDH3G aa 267-380.
    Sequence:

    FDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKS IANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENMHTPDI GGQGTTSEAIQDVI


    Database link: P51553

  • Positive control

    • IHC-P: Human cerebellum tissue. ICC/IF: U-251 MG cells. WB: PC-12, NIH/3T3, RT4, U-251 MG, A431 and NBT-II cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224210 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500. Predicted molecular weight: 43 kDa.

Target

  • Sequence similarities

    Belongs to the isocitrate and isopropylmalate dehydrogenases family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • H IDHG antibody
    • IDH gamma antibody
    • IDH3G antibody
    • IDH3G_HUMAN antibody
    • Isocitrate dehydrogenase [NAD] subunit gamma antibody
    • Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial antibody
    • Isocitrate dehydrogenase 3 (NAD+) gamma antibody
    • Isocitric dehydrogenase antibody
    • Isocitric dehydrogenase subunit gamma antibody
    • mitochondrial antibody
    • NAD (H) specific isocitrate dehydrogenase gamma subunit antibody
    • NAD(+) specific ICDH antibody
    • NAD(+)-specific ICDH subunit gamma antibody
    • NAD+ specific ICDH antibody
    • OTTHUMP00000025984 antibody
    • OTTHUMP00000025985 antibody
    • OTTHUMP00000025987 antibody
    • OTTHUMP00000025988 antibody
    • OTTHUMP00000214764 antibody
    see all

Images

  • All lanes : Anti-IDH3G antibody (ab224210) at 1/250 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
    Lane 3 : A431 (human epidermoid carcinoma cell line) cell lysate

    Predicted band size: 43 kDa

  • Paraffin embedded human cerebellum tissue stained for IDH3G with ab224210 (1/200 dilution) in immunohistochemical analysis.

  • All lanes : Anti-IDH3G antibody (ab224210) at 1/250 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate
    Lane 3 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell lysate

    Predicted band size: 43 kDa

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for IDH3G (green) using ab224210 (4 µg/ml) in ICC/IF.

References

ab224210 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Tissue lysate - whole (heart)
Gel Running Conditions
Reduced Denaturing (gradient 4-12 %)
Loading amount
30 µg
Specification
heart
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 24°C

Dr. Nina Mayorek

Verified customer

Submitted Jun 04 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up