Overview

  • Product name

    Anti-IdhA antibody
  • Description

    Rabbit polyclonal to IdhA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity


    Predicted to work with: Staphylococcus aureus
  • Immunogen

    Recombinant full length protein corresponding to Staphylococcus aureus IdhA aa 1-317.
    Sequence:

    MNKFKGNKVVLIGNGAVGSSYAFSLVNQSIVDELVIIDLDTEKVRGDVMD LKHATPYSPTTVRVKAGEYSDCHDADLVVICAGAAQKPGETRLDLVSKNL KIFKSIVGEVMASKFDGIFLVATNPVDILAYATWKFSGLPKERVIGSGTI LDSARFRLLLSEAFDVAPRSVDAQIIGEHGDTELPVWSHANIAGQPLKTL LEQRPEGKAQIEQIFVQTRDAAYDIIQAKGATYYGVAMGLARITEAIFRN EDAVLTVSALLEGEYDEEDVYIGVPAVINRNGIRNVVEIPLNDEEQSKFA HSAKTLKDIMAEAEELK


    Database link: P65255

  • Positive control

    • WB: Recombinant Staphylococcus aureus L-lactate dehydrogenase 1 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab225691 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.

Target

  • Relevance

    IdhA, also known as D-lactate dehydrogenase, belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. In enzymology, a D-lactate dehydrogenase (cytochrome) is an enzyme that catalyzes the chemical reaction. Thus, the two substrates of this enzyme are (D)-lactate and ferricytochrome c, whereas its two products are pyruvate and ferrocytochrome c.
  • Database links

    • Alternative names

      • D-lactate dehydrogenase antibody
      • ECK1377 antibody
      • Fermentative lactate dehydrogenase antibody
      • hslF antibody
      • hslI antibody
      • htpH antibody
      • JW1375 antibody
      see all

    Images

    • All lanes : Anti-IdhA antibody (ab225691) at 1/500 dilution

      Lane 1 : 60 ng recombinant protein
      Lane 2 : 30 ng recombinant protein
      Lane 3 : 15 ng recombinant protein
      Lane 4 : 7.5 ng recombinant protein

      Secondary
      All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

      Developed using the ECL technique.

    References

    ab225691 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab225691.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up