Overview

  • Product name

    Anti-Ifi204 antibody
  • Description

    Rabbit polyclonal to Ifi204
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Mouse Ifi204 aa 1-250.
    Sequence:

    MVNEYKRIVLLRGLECINKHYFSLFKSLLARDLNLERDNQEQYTTIQIAN MMEEKFPADSGLGKLIAFCEEVPALRKRAEILKKERSEVTGETSLEKNGQ EAGPATPTSTTSHMLASERGETSATQEETSTAQAGTSTAQARTSTAQAGT STAQKRKIMREEETGVKKSKAAKEPDQPPCCEEPTARCQSPILHSSSSAS SNIPSAKNQKSQPQNQNIPRGAVLHSEPLTVMVLTATDPFEYESPEHEVK


    Database link: P0DOV2

  • Positive control

    • WB: EL4 lysate; Mouse kidney lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: PBS, 0.05% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab228512 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 3 - 5 µg/ml. Predicted molecular weight: 69 kDa.

Target

  • Relevance

    Function: Inhibits the transcription of ribosomal RNA. May inhibit DNA binding by UBTF. Inhibits cell growth via TP53/p53 and RB1-dependent and independent pathways. Acts as a coactivator of RUNX2 during osteogenesis. May be involved in macrophage differentiation. Enables skeletal muscle and cardiac myocyte differentiation by sequestring Id proteins in the cytosol and promoting their ubiquitination and subsequent degradation. Tissue specificity: Present in osteoblasts (at protein level). Similarity: Belongs to the HIN-200 family. Contains 1 DAPIN domain. Contains 2 HIN-200 domains. Domain: The 2 HIN-200 domains are able to interacts with RUNX2.
  • Cellular localization

    Nucleus. Nucleus > nucleolus. Cytoplasm. Nuclear in proliferating cells, translocates to cytosol during cell differentiation.
  • Database links

  • Alternative names

    • Ifi-204 antibody
    • Ifi204 antibody
    • IFI4_MOUSE antibody
    • Interferon-activable protein 204 antibody
    • Interferon-inducible protein p204 antibody
    see all

Images

  • All lanes : Anti-Ifi204 antibody (ab228512) at 3 µg/ml

    Lane 1 : Mouse kidney lysate
    Lane 2 : EL4 lysate

    Predicted band size: 69 kDa

References

ab228512 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab228512.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up